KPNA5 Polyclonal antibody, PBS Only

• 

  WB analysis of Jurkat using 13963-1-AP (same clone as 13963-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 13963-1-AP (KPNA5 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13963-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 13963-1-AP (same clone as 13963-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 13963-1-AP (KPNA5 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13963-1-PBS in a different storage buffer formulation.

• 

  IP experiment of Jurkat using 13963-1-AP (same clone as 13963-1-PBS)

  IP result of anti-KPNA5 (IP:13963-1-AP, 4ug; Detection:13963-1-AP 1:2000) with Jurkat cells lysate 4000ug. This data was developed using the same antibody clone with 13963-1-PBS in a different storage buffer formulation.

KPNA5 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 13963-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, Indirect ELISA

Synonyms

---

Product Information

13963-1-PBS targets KPNA5 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4920

  Product name: Recombinant human KPNA5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-231 aa of BC047409

  Sequence: MDAMASPGKDNYRMKSYKNKALNPQEMRRRREEEGIQLRKQKREEQLFKRRNVYLPRNDESMLESPIQDPDISSTVPIPEEEVVTTDMVQMIFSNNADQQLTATQKFRKLLSKEPNPPIDQVIQKPGVVQRFVKFLERNENCTLQFEAAWALTNIASGTFLHTKVVIETGAVPIFIKLLNSEHEDVQEQAVWALGNIAGDNAECRDFVLNCEILPPLLELLTNSNRLTTTR

• Full Name: karyopherin alpha 5 (importin alpha 6)
• Calculated Molecular Weight: 60 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC047409
• Gene Symbol: KPNA5
• Gene ID (NCBI): 3841
• RRID: AB_2133847
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15131
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.