Tested Applications
| Positive WB detected in | SCaBER cells, mouse skin tissue, A431 cells, FaDu cells, HT-1376 cells, MCF-10A cells, A-253 cells, rat skin tissue, pig skin tissue |
| Positive IHC detected in | human lung cancer tissue, human cervical cancer tissue, human skin tissue, human breast hyperplasia tissue, human skin cancer tissue, rat skin tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse skin tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:20000-1:100000 |
| Immunohistochemistry (IHC) | IHC : 1:400-1:800 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
60320-1-Ig targets Cytokeratin 14 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17559 Product name: Recombinant human KRT14 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 426-472 aa of BC002690 Sequence: LSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN Predict reactive species |
| Full Name | keratin 14 |
| Calculated Molecular Weight | 472 aa, 52 kDa |
| Observed Molecular Weight | 52 kDa |
| GenBank Accession Number | BC002690 |
| Gene Symbol | Cytokeratin 14 |
| Gene ID (NCBI) | 3861 |
| RRID | AB_2881431 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P02533 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9-K23, and the hair keratins Ha1-Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1-K8, and the hair keratins, Hb1-Hb6. Keratin 14 is a type I cytokeratin. It is usually found as a heterotetramer with keratin 5. Keratins K14 and K5 have long been considered to be biochemical markers of the stratified squamous epithelia, including epidermis.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Cytokeratin 14 antibody 60320-1-Ig | Download protocol |
| IHC protocol for Cytokeratin 14 antibody 60320-1-Ig | Download protocol |
| WB protocol for Cytokeratin 14 antibody 60320-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Cytokeratin 14 Monoclonal antibody (2G1E2), catalog number 60320-1-Ig, has 39 citations spanning journals including Nature Communications, Nature Aging, Cell Death & Differentiation, Journal of Investigative Dermatology, Stem Cell Research & Therapy, and others. Research fields cover skin biology and wound healing, epidermal development, stem cell biology, cancer (breast, bladder, nasopharyngeal), immunology and inflammation, diabetes, oral health, and ophthalmology. Applications cited include IF, WB, and IHC across human, mouse, rat, and pig species.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Targeting cancer cell plasticity by HDAC inhibition to reverse EBV-induced dedifferentiation in nasopharyngeal carcinoma. | ||
Nat Aging Skin chronological aging drives age-related bone loss via secretion of cystatin-A | ||
Nat Commun CFAP100 couples microtubule glutamylation to spindle pole integrity in keratinocytes to promote epidermal development. | ||
Metabolism Increased adrenal steroidogenesis and suppressed corticosteroid responsiveness in critical COVID-19 | ||
J Nanobiotechnology Exosomes from human induced pluripotent stem cells-derived keratinocytes accelerate burn wound healing through miR-762 mediated promotion of keratinocytes and endothelial cells migration. |
