Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

Cytokeratin 14 Monoclonal antibody

Cytokeratin 14 Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 60320-1-Ig
Clone No. 2G1E2
Publications (39)
Review Product
Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF-P, ELISA
For FC, select conjugated version.

KRT14, 2G1E2, CK 14, CK14, CK-14

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for Cytokeratin 14 in ?

Tested Applications

Positive WB detected inSCaBER cells, mouse skin tissue, A431 cells, FaDu cells, HT-1376 cells, MCF-10A cells, A-253 cells, rat skin tissue, pig skin tissue
Positive IHC detected inhuman lung cancer tissue, human cervical cancer tissue, human skin tissue, human breast hyperplasia tissue, human skin cancer tissue, rat skin tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse skin tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:20000-1:100000
Immunohistochemistry (IHC)IHC : 1:400-1:800
Immunofluorescence (IF)-PIF-P : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60320-1-Ig targets Cytokeratin 14 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17559

Product name: Recombinant human KRT14 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 426-472 aa of BC002690

Sequence: LSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN

Predict reactive species
Full Name keratin 14
Calculated Molecular Weight 472 aa, 52 kDa
Observed Molecular Weight 52 kDa
GenBank Accession NumberBC002690
Gene Symbol Cytokeratin 14
Gene ID (NCBI) 3861
RRIDAB_2881431
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP02533
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9-K23, and the hair keratins Ha1-Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1-K8, and the hair keratins, Hb1-Hb6. Keratin 14 is a type I cytokeratin. It is usually found as a heterotetramer with keratin 5. Keratins K14 and K5 have long been considered to be biochemical markers of the stratified squamous epithelia, including epidermis.

Protocols

Product Specific Protocols
IF protocol for Cytokeratin 14 antibody 60320-1-IgDownload protocol
IHC protocol for Cytokeratin 14 antibody 60320-1-IgDownload protocol
WB protocol for Cytokeratin 14 antibody 60320-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Cytokeratin 14 Monoclonal antibody (2G1E2), catalog number 60320-1-Ig, has 39 citations spanning journals including Nature Communications, Nature Aging, Cell Death & Differentiation, Journal of Investigative Dermatology, Stem Cell Research & Therapy, and others. Research fields cover skin biology and wound healing, epidermal development, stem cell biology, cancer (breast, bladder, nasopharyngeal), immunology and inflammation, diabetes, oral health, and ophthalmology. Applications cited include IF, WB, and IHC across human, mouse, rat, and pig species.

SpeciesApplicationTitle
humanWB,IHC

Signal Transduct Target Ther

Targeting cancer cell plasticity by HDAC inhibition to reverse EBV-induced dedifferentiation in nasopharyngeal carcinoma.

Authors - Jiajun Xie
IF

Nat Aging

Skin chronological aging drives age-related bone loss via secretion of cystatin-A

Authors - Wenquan Liang
mouseIF

Nat Commun

CFAP100 couples microtubule glutamylation to spindle pole integrity in keratinocytes to promote epidermal development.

Authors - Shuang Sun
humanIF

Nat Commun

The immune landscape of human thymic epithelial tumors

Authors - Zhongwei Xin
humanIF

Metabolism

Increased adrenal steroidogenesis and suppressed corticosteroid responsiveness in critical COVID-19

Authors - Tian-Zi Wen
humanIF

J Nanobiotechnology

Exosomes from human induced pluripotent stem cells-derived keratinocytes accelerate burn wound healing through miR-762 mediated promotion of keratinocytes and endothelial cells migration.

Authors - Yunyao Bo
Loading...
||
New chat

Able™

正在加载,请稍候...