Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

CoraLite® Plus 647-conjugated Cytokeratin 14 Monoclonal antibody

Cytokeratin 14 Monoclonal Antibody for IF-P, FC (Intra)

Cat No. CL647-60320
Clone No.2G1E2

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

IF-P, FC (Intra)

KRT14, 2G1E2, CK 14, CK14, CK-14

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse skin tissue
Positive FC (Intra) detected inA431 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-60320 targets Cytokeratin 14 in IF-P, FC (Intra) applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17559

Product name: Recombinant human KRT14 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 426-472 aa of BC002690

Sequence: LSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN

Predict reactive species
Full Name keratin 14
Calculated Molecular Weight 472 aa, 52 kDa
Observed Molecular Weight 52 kDa
GenBank Accession NumberBC002690
Gene Symbol Cytokeratin 14
Gene ID (NCBI) 3861
RRIDAB_2934987
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
Excitation LaserRed Laser (633 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP02533
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9-K23, and the hair keratins Ha1-Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1-K8, and the hair keratins, Hb1-Hb6. Keratin 14 is a type I cytokeratin. It is usually found as a heterotetramer with keratin 5. Keratins K14 and K5 have long been considered to be biochemical markers of the stratified squamous epithelia, including epidermis.

Protocols

Product Specific Protocols
FC protocol for CL Plus 647 Cytokeratin 14 antibody CL647-60320Download protocol
IF protocol for CL Plus 647 Cytokeratin 14 antibody CL647-60320Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...