CoraLite®488-conjugated Cytokeratin 14 Monoclonal antibody

• 

  IF Staining of mouse skin using CL488-60320

  Immunofluorescent analysis of (4% PFA) fixed mouse skin tissue using CoraLite®488 Cytokeratin 14 antibody (CL488-60320, Clone: 2G1E2 ) at dilution of 1:200.

• 

  IF Staining of mouse skin using CL488-60320

  Immunofluorescent analysis of (4% PFA) fixed mouse skin tissue using CoraLite®488 Cytokeratin 14 antibody (CL488-60320, Clone: 2G1E2 ) at dilution of 1:200.

• 

  IF Staining of A431 using CL488-60320

  Immunofluorescent analysis of (-20°C Ethanol) fixed A431 cells using CL488-60320 (Cytokeratin 14 antibody) at dilution of 1:100.

• 

  IF Staining of A431 using CL488-60320

  Immunofluorescent analysis of (-20°C Ethanol) fixed A431 cells using CoraLite®488 Cytokeratin 14 antibody (CL488-60320, Clone: 2G1E2 ) at dilution of 1:200.

• 

  IF Staining of HepG2 using CL488-60320

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using CoraLite®488 Cytokeratin 14 antibody (CL488-60320, Clone: 2G1E2 ) at dilution of 1:200.

• 

  IF Staining of HaCaT using CL488-60320

  Immunofluorescent analysis of (-20°C Methanol) fixed HaCaT cells using CoraLite®488 Cytokeratin 14 antibody (CL488-60320, Clone: 2G1E2 ) at dilution of 1:200.

• Featured Product
• KD/KO Validated

Cytokeratin 14 Monoclonal Antibody for IF/ICC, IF-P

Cat No. CL488-60320

Clone No.2G1E2

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

IF/ICC, IF-P

Synonyms

KRT14, Cytokeratin-14, Cytokeratin,Keratin, CK-14, CK14

---

Tested Applications

• Positive IF-P detected in: mouse skin tissue
• Positive IF/ICC detected in: A431 cells, HepG2 cells, HaCaT cells

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-60320 targets Cytokeratin 14 in IF/ICC, IF-P applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17559

  Product name: Recombinant human KRT14 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 426-472 aa of BC002690

  Sequence: LSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN

• Full Name: keratin 14
• Calculated Molecular Weight: 472 aa, 52 kDa
• Observed Molecular Weight: 52 kDa
• GenBank Accession Number: BC002690
• Gene Symbol: Cytokeratin 14
• Gene ID (NCBI): 3861
• RRID: AB_2934432
• Conjugate: CoraLite®488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 491 nm / 516 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P02533
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

eratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9-K23, and the hair keratins Ha1-Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1-K8, and the hair keratins, Hb1-Hb6. Keratin 14 is a type I cytokeratin. It is usually found as a heterotetramer with keratin 5. Keratins K14 and K5 have long been considered to be biochemical markers of the stratified squamous epithelia, including epidermis.