• Featured Product
  • KD/KO Validated

CoraLite®594-conjugated Cytokeratin 14 Monoclonal antibody

Cytokeratin 14 Monoclonal Antibody for IF/ICC, IF-P
Cat No. CL594-60320
Clone No.2G1E2

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

IF/ICC, IF-P

KRT14, Cytokeratin-14, Cytokeratin,Keratin, CK-14, CK14

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse skin tissue
Positive IF/ICC detected inA431 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-60320 targets Cytokeratin 14 in IF/ICC, IF-P applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17559

Product name: Recombinant human KRT14 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 426-472 aa of BC002690

Sequence: LSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN

Predict reactive species
Full Name keratin 14
Calculated Molecular Weight 472 aa, 52 kDa
Observed Molecular Weight 52 kDa
GenBank Accession NumberBC002690
Gene Symbol Cytokeratin 14
Gene ID (NCBI) 3861
RRIDAB_2934710
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP02533
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

eratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9-K23, and the hair keratins Ha1-Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1-K8, and the hair keratins, Hb1-Hb6. Keratin 14 is a type I cytokeratin. It is usually found as a heterotetramer with keratin 5. Keratins K14 and K5 have long been considered to be biochemical markers of the stratified squamous epithelia, including epidermis.

Protocols

Product Specific Protocols
IF protocol for CL594 Cytokeratin 14 antibody CL594-60320Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...