Cytokeratin 2e Polyclonal antibody

• 

  WB analysis using 21725-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21725-1-AP (KRT2 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A431 using 21725-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 21725-1-AP (KRT2 Antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human cervical cancer using 21725-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 21725-1-AP (KRT2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human cervical cancer using 21725-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 21725-1-AP (KRT2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human oesophagus cancer using 21725-1-AP

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 21725-1-AP (KRT2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human oesophagus cancer using 21725-1-AP

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 21725-1-AP (KRT2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Cytokeratin 2e Polyclonal Antibody for WB, IHC, ELISA

Cat No. 21725-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, IHC, ELISA

Synonyms

CK 2e, Cytokeratin 2e, Epithelial keratin 2e, K2e, keratin 2, Keratin 2 epidermis, Keratin 2e, KRT2, KRT2A, KRT2E, KRTE, Type II keratin Kb2

---

Tested Applications

• Positive WB detected in: A431 cells, mouse skin tissue, rat skin tissue.
• Positive IHC detected in: human cervical cancer tissue, human oesophagus cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IF: See 1 publications below

Product Information

21725-1-AP targets Cytokeratin 2e in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16384

  Product name: Recombinant human KRT2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 210-331 aa of BC096294

  Sequence: WELLQQMNVGTRPINLEPIFQGYIDSLKRYLDGLTAERTSQNSELNNMQDLVEDYKKKYEDEINKRTAAENDFVTLKKDVDNAYMIKVELQSKVDLLNQEIEFLKVLYDAEISQIHQSVTDT

• Full Name: keratin 2
• Calculated Molecular Weight: 639 aa, 66 kDa
• Observed Molecular Weight: 65 kDa
• GenBank Accession Number: BC096294
• Gene Symbol: KRT2
• Gene ID (NCBI): 3849
• RRID: AB_2878914
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P35908
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells. Keratin expression is highly regulated, tissue specific, and varies according to cell-state. Type I keratins consist of acidic, low molecular weight proteins with MW ranging from 40 kDa (KRT19) to 64 kDa (KRT9). Type 2 keratins consist of basic or neutral, high molecular weight proteins with MW from 52 kDa (KRT8) to 67 kDa (KRT18).Keratin 2 is a type II cytokeratin. It is found largely in the upper spinous layer of epidermal keratinocytes, and also in other regions, notably the epidermis covering the knee, thigh, and groin.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Cont Lens Anterior Eye; The biomechanical proteins different between low myopic corneas and moderate to high myopic corneas in human; Authors - Wenjing Wu