Cytokeratin 71 Polyclonal antibody

• 

  WB analysis of mouse skin using 26149-1-AP

  mouse skin tissue were subjected to SDS PAGE followed by western blot with 26149-1-AP (KRT71 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

Cytokeratin 71 Polyclonal Antibody for WB, ELISA

Cat No. 26149-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

KRT71, CK 71, CK-71, Cytokeratin-71, hK6irs

---

Tested Applications

• Positive WB detected in: mouse skin tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26149-1-AP targets Cytokeratin 71 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23536

  Product name: Recombinant human KRT71 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 450-523 aa of BC103917

  Sequence: PVSISIISSTSGGSGYGFRPSMVSGGYVANSSNCISGVCSVRGGEGRSRGSANDYKDTLGKGSSLSAPSKKTSR

• Full Name: keratin 71
• Observed Molecular Weight: 57 kDa
• GenBank Accession Number: BC103917
• Gene Symbol: KRT71
• Gene ID (NCBI): 112802
• RRID: AB_3085843
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q3SY84
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

KRT71 is a gene that encodes Keratin 71, a type II intermediate filament protein primarily expressed in the inner root sheath (IRS) of hair follicles. As a member of the keratin family, KRT71 plays a critical role in maintaining the structural integrity of hair shafts and follicular tissues. Mutations in this gene have been linked to hereditary hair disorders, including autosomal recessive woolly hair (ARWH) and hypotrichosis, characterized by abnormal hair texture, density, or growth patterns.