Tested Applications
| Positive WB detected in | mouse skin tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26149-1-AP targets Cytokeratin 71 in WB, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag23536 Product name: Recombinant human KRT71 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 450-523 aa of BC103917 Sequence: PVSISIISSTSGGSGYGFRPSMVSGGYVANSSNCISGVCSVRGGEGRSRGSANDYKDTLGKGSSLSAPSKKTSR Predict reactive species |
| Full Name | keratin 71 |
| Observed Molecular Weight | 57 kDa |
| GenBank Accession Number | BC103917 |
| Gene Symbol | KRT71 |
| Gene ID (NCBI) | 112802 |
| RRID | AB_3085843 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q3SY84 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
KRT71 is a gene that encodes Keratin 71, a type II intermediate filament protein primarily expressed in the inner root sheath (IRS) of hair follicles. As a member of the keratin family, KRT71 plays a critical role in maintaining the structural integrity of hair shafts and follicular tissues. Mutations in this gene have been linked to hereditary hair disorders, including autosomal recessive woolly hair (ARWH) and hypotrichosis, characterized by abnormal hair texture, density, or growth patterns.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for Cytokeratin 71 antibody 26149-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

