Product Information
22215-1-PBS targets Kindlin 1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17543 Product name: Recombinant human Kindlin 1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 321-420 aa of BC035882 Sequence: HISKLSLSAETQDFAGESEVDEIEAALSNLEVTLEGGKADSLLEDITDIPKLADNLKLFRPKKLLPKAFKQYWFIFKDTSIAYFKNKELEQGEPLEKLNL Predict reactive species |
| Full Name | fermitin family homolog 1 (Drosophila) |
| Calculated Molecular Weight | 677 aa, 77 kDa |
| Observed Molecular Weight | 70-77 kDa |
| GenBank Accession Number | BC035882 |
| Gene Symbol | Kindlin 1 |
| Gene ID (NCBI) | 55612 |
| RRID | AB_2879033 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9BQL6 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Kindlin-1 is a FERM domain containing adaptor protein that is found predominantly at cell-extracellular matrix adhesions where it binds to β-integrin subunits and is required for integrin activation. Loss of function mutations in the FERMT1 gene which encodes Kindlin-1 leads to the development of Kindler Syndrome (KS) an autosomal recessive skin disorder characterized by skin blistering, photosensitivity, and predisposition to aggressive squamous cell carcinoma (SCC).























