Kir4.1 Polyclonal antibody, PBS Only

• 

  WB analysis using 12503-1-AP (same clone as 12503-1-PBS)

  mouse brain tissues (heated at 100°C, unboided, heated at 37°C) were subjected to SDS PAGE followed by western blot with 12503-1-AP (Kir4.1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12503-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 12503-1-AP (same clone as 12503-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 12503-1-AP (Kir4.1 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12503-1-PBS in a different storage buffer formulation.

• 

  IP experiment of rat brain using 12503-1-AP (same clone as 12503-1-PBS)

  IP result of anti-Kir4.1 (IP:12503-1-AP, 4ug; Detection:12503-1-AP 1:500) with rat brain tissue lysate 4800ug. This data was developed using the same antibody clone with 12503-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 12503-1-AP (same clone as 12503-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 12503-1-AP (Kir4.1 antibody at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12503-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 12503-1-AP (same clone as 12503-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 12503-1-AP (Kir4.1 antibody at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12503-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 12503-1-AP (same clone as 12503-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 12503-1-AP (Kir4.1 antibody at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 12503-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 12503-1-AP (same clone as 12503-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 12503-1-AP (Kir4.1 antibody at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 12503-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 12503-1-AP (same clone as 12503-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 12503-1-AP (Kir4.1 antibody at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 12503-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 12503-1-AP (same clone as 12503-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 12503-1-AP (Kir4.1 antibody at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 12503-1-PBS in a different storage buffer formulation.

Kir4.1 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 12503-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

12503-1-PBS targets Kir4.1 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3182

  Product name: Recombinant human KCNJ10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 224-426 aa of BC034036

  Sequence: ETIRFSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV

• Full Name: potassium inwardly-rectifying channel, subfamily J, member 10
• Calculated Molecular Weight: 379 aa, 41 kDa
• Observed Molecular Weight: 41 kDa
• GenBank Accession Number: BC034036
• Gene Symbol: Kir4.1
• Gene ID (NCBI): 3766
• RRID: AB_2234144
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P78508
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.