LAG3 Recombinant monoclonal antibody, PBS Only

• 

  Affinity and Kinetic Characterization of 80855-3-PBS

  Biolayer interferometry (BLl) kinetic assays of 80855-3-PBS against Human LAG3 were performed. The affinity constant is 0.531 nM.

LAG3 Uni-rAb^® Recombinant Antibody for Indirect ELISA

Cat No. 80855-3-PBS

Clone No.243086G9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Indirect ELISA

Synonyms

CD223, FDC, LAG 3, LAG-3, lymphocyte activation gene 3

---

Product Information

80855-3-PBS targets LAG3 in Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg31550

  Product name: Recombinant Human LAG3 protein (Myc Tag, His Tag)

  Source: mammalian cells-derived, pHZ-KIsec

  Tag: Myc & 6*His

  Domain: 23-450 aa of NM_002286

  Sequence: LQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHL

• Full Name: lymphocyte-activation gene 3
• Calculated Molecular Weight: 57 kDa
• GenBank Accession Number: NM_002286
• Gene Symbol: LAG-3
• Gene ID (NCBI): 3902
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P18627
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.