Product Information
26850-1-AP targets LAPTM4A in ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25371 Product name: Recombinant human LAPTM4A protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 103-187 aa of BC000421 Sequence: SYQVGWLIPFFCYRLFDFVLSCLVAISSLTYLPRIKEYLDQLPDFPYKDDLLALDSSCLLFIVLVFFALFIIFKAYLINCVWNCY Predict reactive species |
| Full Name | lysosomal protein transmembrane 4 alpha |
| Calculated Molecular Weight | 27 kDa |
| GenBank Accession Number | BC000421 |
| Gene Symbol | LAPTM4A |
| Gene ID (NCBI) | 9741 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q15012 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
