LATS1 Polyclonal antibody, PBS Only

LATS1 Polyclonal Antibody for WB, Indirect ELISA
Cat No. 30174-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

30174-1-PBS targets LATS1 in WB, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag32879

Product name: Recombinant human LATS1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-185 aa of BC002767

Sequence: MKRSEKPEGYRQMRPKTFPASNYTVSSRQMLQEIRESLRNLSKPSDAAKAEHNMSKMSTEDPRQVRNPPKFGTHHKALQEIRNSLLPFANETNSSRSTSEVNPQMLQDLQAAGFDEDMVIQALQKTNNRSIEAAIEFISKMSYQDPRREQMAAAAARPINASMKPGNVQQSVNRKQSWKGSKESL

Predict reactive species
Full Name LATS, large tumor suppressor, homolog 1 (Drosophila)
Observed Molecular Weight130 kDa
GenBank Accession NumberBC002767
Gene Symbol LATS1
Gene ID (NCBI) 9113
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO95835
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

LATS1(Large tumor suppressor homolog 1) is also named as WARTS and belongs to the AGC Ser/Thr protein kinase family. The gene encodes a highly conserved (from fly to human) protein kinase that plays a crucial role in the prevention of tumor formation by controlling the progression of mitosis. The expression of both long(170 kDa) and short lats1 isoforms(120 kDa) in vertebrate retinal cells raises the possibility that these lats1 proteins may act as negative key regulators of the cell cycle each of them performing a unique role (PMID:15777619). In mammalian cells, LATS1 was phosphorylated in a cell cycle-dependent manner and complexed with CDC2 in early mitosis (PMID:9988268). LATS1 also can be detected as 120 kDa and 140-150 kDa, and play a key role in the regulation of Hippo pathway (PMID: 27940445).

Loading...
||
New chat Able
正在加载,请稍候...