Recombinant human LATS1 protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag10709
Synonyms
LATS1, EC:2.7.11.1, h-warts, LATS 1, Serine/threonine-protein kinase LATS1
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MKRSEKPEGYRQMRPKTFPASNYTVSSRQMLQEIRESLRNLSKPSDAAKAEHNMSKMSTEDPRQVRNPPKFGTHHKALQEIRNSLLPFANETNSSRSTSEVNPQMLQDLQAAGFDEEDHLSVACSPISLTKPFLI
(1-135 aa encoded by BC015665) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
