LAYN Polyclonal antibody

• 

  WB analysis using 20535-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20535-1-AP (LAYN antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 20535-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 20535-1-AP (LAYN antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 20535-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 20535-1-AP (LAYN antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 20535-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 20535-1-AP (LAYN antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 20535-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 20535-1-AP (LAYN antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 20535-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 20535-1-AP (LAYN antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 20535-1-AP

  Immunofluorescent analysis of HepG2 cells, using LAYN antibody 20535-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

LAYN Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 20535-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

UNQ208/PRO234, Layilin

---

Tested Applications

• Positive WB detected in: A549 cells, mouse brain tissue, NCI-H1299 cells
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IF: See 1 publications below

Product Information

20535-1-AP targets LAYN in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14508

  Product name: Recombinant human LAYN protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 246-374 aa of BC025407

  Sequence: CWVWICRKRKREQPDPSTKKQHTIWPSPHQGNSPDLEVYNVIRKQSEADLAETRPDLKNISFRVCSGEATPDDMSCDYDNMAVNPSESGFMTLVSVESGFVTNDIYEFSPDQMGRSKESGWVENEIYGY

• Full Name: layilin
• Calculated Molecular Weight: 382 aa, 43 kDa
• Observed Molecular Weight: 43 kDa
• GenBank Accession Number: BC025407
• Gene Symbol: LAYN
• Gene ID (NCBI): 143903
• RRID: AB_10696315
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6UX15
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IF	Environ Pollut; Silica nanoparticles suppressed the spermatogenesis via downregulation of miR-450b-3p by targeting Layilin in spermatocyte of mouse; Authors - Guiqing Zhou