Tested Applications
Positive WB detected in | A549 cells, mouse brain tissue, NCI-H1299 cells |
Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:8000 |
Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:10-1:100 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
IF | See 1 publications below |
Product Information
20535-1-AP targets LAYN in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag14508 Product name: Recombinant human LAYN protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 246-374 aa of BC025407 Sequence: CWVWICRKRKREQPDPSTKKQHTIWPSPHQGNSPDLEVYNVIRKQSEADLAETRPDLKNISFRVCSGEATPDDMSCDYDNMAVNPSESGFMTLVSVESGFVTNDIYEFSPDQMGRSKESGWVENEIYGY Predict reactive species |
Full Name | layilin |
Calculated Molecular Weight | 382 aa, 43 kDa |
Observed Molecular Weight | 43 kDa |
GenBank Accession Number | BC025407 |
Gene Symbol | LAYN |
Gene ID (NCBI) | 143903 |
RRID | AB_10696315 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q6UX15 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for LAYN antibody 20535-1-AP | Download protocol |
IHC protocol for LAYN antibody 20535-1-AP | Download protocol |
IF protocol for LAYN antibody 20535-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |