Product Information
85900-1-PBS targets LAYN in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag14508 Product name: Recombinant human LAYN protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 246-374 aa of BC025407 Sequence: CWVWICRKRKREQPDPSTKKQHTIWPSPHQGNSPDLEVYNVIRKQSEADLAETRPDLKNISFRVCSGEATPDDMSCDYDNMAVNPSESGFMTLVSVESGFVTNDIYEFSPDQMGRSKESGWVENEIYGY Predict reactive species |
Full Name | layilin |
Calculated Molecular Weight | 382 aa, 43 kDa |
Observed Molecular Weight | 43 kDa |
GenBank Accession Number | BC025407 |
Gene Symbol | LAYN |
Gene ID (NCBI) | 143903 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q6UX15 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
LAYN acts as a receptor for hyaluronic acid (HA) and is involved in various cellular processes, including cell adhesion, movement, and signal transduction. In the context of cancer, LAYN has been identified as a prognostic biomarker. High expression of LAYN is associated with poor prognosis and increased immune cell infiltration in various cancers, such as colorectal cancer and gastric cancer. It may also play a role in T-cell exhaustion and the regulation of tumor-associated macrophages (PMID: 30761122).