LAYN Recombinant monoclonal antibody

LAYN Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 85900-1-RR
Clone No.250175B7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Layilin, UNQ208/PRO234

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inRaji cells, HeLa cells, A549 cells, NCI-H1299 cells, A172 cells, mouse brain tissue, rat brain tissue
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA549 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85900-1-RR targets LAYN in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag14508

Product name: Recombinant human LAYN protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 246-374 aa of BC025407

Sequence: CWVWICRKRKREQPDPSTKKQHTIWPSPHQGNSPDLEVYNVIRKQSEADLAETRPDLKNISFRVCSGEATPDDMSCDYDNMAVNPSESGFMTLVSVESGFVTNDIYEFSPDQMGRSKESGWVENEIYGY

Predict reactive species
Full Name layilin
Calculated Molecular Weight 382 aa, 43 kDa
Observed Molecular Weight43 kDa
GenBank Accession NumberBC025407
Gene Symbol LAYN
Gene ID (NCBI) 143903
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ6UX15
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LAYN acts as a receptor for hyaluronic acid (HA) and is involved in various cellular processes, including cell adhesion, movement, and signal transduction. In the context of cancer, LAYN has been identified as a prognostic biomarker. High expression of LAYN is associated with poor prognosis and increased immune cell infiltration in various cancers, such as colorectal cancer and gastric cancer. It may also play a role in T-cell exhaustion and the regulation of tumor-associated macrophages (PMID: 30761122).

Protocols

Product Specific Protocols
WB protocol for LAYN antibody 85900-1-RRDownload protocol
IHC protocol for LAYN antibody 85900-1-RRDownload protocol
IF protocol for LAYN antibody 85900-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...