LAYN Recombinant monoclonal antibody

• 

  WB analysis using 85900-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 85900-1-RR (LAYN antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 85900-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 85900-1-RR (LAYN antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A549 using 85900-1-RR

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using LAYN antibody (85900-1-RR, Clone: 250175B7 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  Affinity and Kinetic Characterization of 85900-1-RR

  Biolayer interferometry (BLl) kinetic assays of 85900-1-RR against Human LAYN were performed. The affinity constant is 7.21 nM.

LAYN Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 85900-1-RR

Clone No.250175B7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Layilin, UNQ208/PRO234

---

Tested Applications

• Positive WB detected in: Raji cells, HeLa cells, A549 cells, NCI-H1299 cells, A172 cells, mouse brain tissue, rat brain tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

85900-1-RR targets LAYN in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag14508

  Product name: Recombinant human LAYN protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 246-374 aa of BC025407

  Sequence: CWVWICRKRKREQPDPSTKKQHTIWPSPHQGNSPDLEVYNVIRKQSEADLAETRPDLKNISFRVCSGEATPDDMSCDYDNMAVNPSESGFMTLVSVESGFVTNDIYEFSPDQMGRSKESGWVENEIYGY

• Full Name: layilin
• Calculated Molecular Weight: 382 aa, 43 kDa
• Observed Molecular Weight: 43 kDa
• GenBank Accession Number: BC025407
• Gene Symbol: LAYN
• Gene ID (NCBI): 143903
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q6UX15
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LAYN acts as a receptor for hyaluronic acid (HA) and is involved in various cellular processes, including cell adhesion, movement, and signal transduction. In the context of cancer, LAYN has been identified as a prognostic biomarker. High expression of LAYN is associated with poor prognosis and increased immune cell infiltration in various cancers, such as colorectal cancer and gastric cancer. It may also play a role in T-cell exhaustion and the regulation of tumor-associated macrophages (PMID: 30761122).