LCE1A Polyclonal antibody

• 

  IHC staining of human oesophagus using 24956-1-AP

  Immunohistochemical analysis of paraffin-embedded human oesophagus tissue slide using 24956-1-AP (LCE1A Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human oesophagus using 24956-1-AP

  Immunohistochemical analysis of paraffin-embedded human oesophagus tissue slide using 24956-1-AP (LCE1A Antibody) at dilution of 1:50 (under 40x lens).

LCE1A Polyclonal Antibody for IHC, ELISA

Cat No. 24956-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

late cornified envelope 1A, Late envelope protein 1, LCE1A, LEP1

---

Tested Applications

• Positive IHC detected in: human oesophagus tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24956-1-AP targets LCE1A in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21047

  Product name: Recombinant human LCE1A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-41 aa of BC153155

  Sequence: MSCQQSQQQCQPPPKCTPKCPPKCPTPKCPPKCPPKCPPVS

• Full Name: late cornified envelope 1A
• Calculated Molecular Weight: 110 aa, 11 kDa
• GenBank Accession Number: BC153155
• Gene Symbol: LCE1A
• Gene ID (NCBI): 353131
• RRID: AB_2879820
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5T7P2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

late cornified envelope 1A (LCE1A), also named as LEP1, is a 110 amino acid protein, which belongs to the LCE family. LCE1A is a Precursor of the cornified envelope of the stratum corneum. LCE1A is detected in dult trunk skin, adult arm skin, fetal skin, penal skin, vulva, esophagus and tongue.