Tested Applications
Positive IHC detected in | human oesophagus tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
24956-1-AP targets LCE1A in IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag21047 Product name: Recombinant human LCE1A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-41 aa of BC153155 Sequence: MSCQQSQQQCQPPPKCTPKCPPKCPTPKCPPKCPPKCPPVS Predict reactive species |
Full Name | late cornified envelope 1A |
Calculated Molecular Weight | 110 aa, 11 kDa |
GenBank Accession Number | BC153155 |
Gene Symbol | LCE1A |
Gene ID (NCBI) | 353131 |
RRID | AB_2879820 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q5T7P2 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
late cornified envelope 1A (LCE1A), also named as LEP1, is a 110 amino acid protein, which belongs to the LCE family. LCE1A is a Precursor of the cornified envelope of the stratum corneum. LCE1A is detected in dult trunk skin, adult arm skin, fetal skin, penal skin, vulva, esophagus and tongue.
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for LCE1A antibody 24956-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |