LCE1A Polyclonal antibody, PBS Only

• 

  IHC staining of human oesophagus using 24956-1-AP (same clone as 24956-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human oesophagus tissue slide using 24956-1-AP (LCE1A Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 24956-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human oesophagus using 24956-1-AP (same clone as 24956-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human oesophagus tissue slide using 24956-1-AP (LCE1A Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 24956-1-PBS in a different storage buffer formulation.

LCE1A Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 24956-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

24956-1-PBS targets LCE1A in IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21047

  Product name: Recombinant human LCE1A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-41 aa of BC153155

  Sequence: MSCQQSQQQCQPPPKCTPKCPPKCPTPKCPPKCPPKCPPVS

• Full Name: late cornified envelope 1A
• Calculated Molecular Weight: 110 aa, 11 kDa
• GenBank Accession Number: BC153155
• Gene Symbol: LCE1A
• Gene ID (NCBI): 353131
• RRID: AB_2879820
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5T7P2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

late cornified envelope 1A (LCE1A), also named as LEP1, is a 110 amino acid protein, which belongs to the LCE family. LCE1A is a Precursor of the cornified envelope of the stratum corneum. LCE1A is detected in dult trunk skin, adult arm skin, fetal skin, penal skin, vulva, esophagus and tongue.