Product Information
24956-1-PBS targets LCE1A in IHC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21047 Product name: Recombinant human LCE1A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-41 aa of BC153155 Sequence: MSCQQSQQQCQPPPKCTPKCPPKCPTPKCPPKCPPKCPPVS Predict reactive species |
| Full Name | late cornified envelope 1A |
| Calculated Molecular Weight | 110 aa, 11 kDa |
| GenBank Accession Number | BC153155 |
| Gene Symbol | LCE1A |
| Gene ID (NCBI) | 353131 |
| RRID | AB_2879820 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q5T7P2 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
late cornified envelope 1A (LCE1A), also named as LEP1, is a 110 amino acid protein, which belongs to the LCE family. LCE1A is a Precursor of the cornified envelope of the stratum corneum. LCE1A is detected in dult trunk skin, adult arm skin, fetal skin, penal skin, vulva, esophagus and tongue.



