LDB1 Monoclonal antibody

LDB1 Monoclonal Antibody for WB, ELISA
Cat No. 68721-1-Ig
Clone No.2F11C3

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat

Applications

WB, ELISA

CLIM 2, CLIM2, hLdb1, LDB 1, LDB1, LIM domain binding 1, LIM domain binding protein 1, NLI, Nuclear LIM interactor

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inLNCaP cells, HSC-T6 cells, NIH/3T3 cells, HeLa cells, HEK-293 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68721-1-Ig targets LDB1 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples.

Tested Reactivity Human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag34563

Product name: Recombinant human LDB1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-211 aa of BC000482

Sequence: MLDRDVGPTPMYPPTYLEPGIGRHTPYGNQTDYRIFELNKRLQNWTEECDNLWWDAFTTEFFEDDAMLTITFCLEDGPKRYTIGRTLIPRYFRSIFEGGATELYYVLKHPKEAFHSNFVSLDCDQGSMVTQHGKPMFTQVCVEGRLYLEFMFDDMMRIKTWHFSIRQHRELIPRSILAMHAQDPQMLDQLSKNITRCGLSNSTLNYLRLCVI

Predict reactive species
Full Name LIM domain binding 1
Calculated Molecular Weight 46 kDa
Observed Molecular Weight 46 kDa
GenBank Accession NumberBC000482
Gene Symbol LDB1
Gene ID (NCBI) 8861
RRIDAB_3670413
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ86U70
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LIM domain-binding protein 1 (LDB1), also known as Carboxyl-terminal LIM domain-binding protein 2 (CLIM2), binds to the LIM domain of a wide variety of LIM domain-containing transcription factors. LDB1 may regulate the transcriptional activity of LIM-containing proteins by determining specific partner interactions. It plays a role in the development of interneurons and motor neurons in cooperation with LHX3 and ISL1. LDB1 acts synergistically with LHX1/LIM1 in axis formation and activation of gene expression. It also acts with LMO2 in the regulation of red blood cell development, maintaining erythroid precursors in an immature state. LDB1 strongly interacts with the LIM2 domain of LMX1A to form homodimer. LDB1 protein is expressed in a wide range of adult tissues including brain, heart, skeletal muscle, colon, thymus, spleen, kidney, liver, small intestine, lung and peripheral blood leukocytes.

Protocols

Product Specific Protocols
WB protocol for LDB1 antibody 68721-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...