LDB1 Monoclonal antibody, PBS Only

• 

  WB analysis using 68721-1-Ig (same clone as 68721-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68721-1-Ig (LDB1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68721-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HSC-T6 using 68721-1-Ig (same clone as 68721-1-PBS)

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 68721-1-Ig (LDB1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68721-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 68721-1-Ig (same clone as 68721-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 68721-1-Ig (LDB1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68721-1-PBS in a different storage buffer formulation.

LDB1 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 68721-1-PBS

Clone No.2F11C3

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

WB, Indirect ELISA

Synonyms

CLIM 2, CLIM2, hLdb1, LDB 1, LDB1, LIM domain binding 1, LIM domain binding protein 1, NLI, Nuclear LIM interactor

---

Product Information

68721-1-PBS targets LDB1 in WB, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34563

  Product name: Recombinant human LDB1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-211 aa of BC000482

  Sequence: MLDRDVGPTPMYPPTYLEPGIGRHTPYGNQTDYRIFELNKRLQNWTEECDNLWWDAFTTEFFEDDAMLTITFCLEDGPKRYTIGRTLIPRYFRSIFEGGATELYYVLKHPKEAFHSNFVSLDCDQGSMVTQHGKPMFTQVCVEGRLYLEFMFDDMMRIKTWHFSIRQHRELIPRSILAMHAQDPQMLDQLSKNITRCGLSNSTLNYLRLCVI

• Full Name: LIM domain binding 1
• Calculated Molecular Weight: 46 kDa
• GenBank Accession Number: BC000482
• Gene Symbol: LDB1
• Gene ID (NCBI): 8861
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q86U70
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

LIM domain-binding protein 1 (LDB1), also known as Carboxyl-terminal LIM domain-binding protein 2 (CLIM2), binds to the LIM domain of a wide variety of LIM domain-containing transcription factors. LDB1 may regulate the transcriptional activity of LIM-containing proteins by determining specific partner interactions. It plays a role in the development of interneurons and motor neurons in cooperation with LHX3 and ISL1. LDB1 acts synergistically with LHX1/LIM1 in axis formation and activation of gene expression. It also acts with LMO2 in the regulation of red blood cell development, maintaining erythroid precursors in an immature state. LDB1 strongly interacts with the LIM2 domain of LMX1A to form homodimer. LDB1 protein is expressed in a wide range of adult tissues including brain, heart, skeletal muscle, colon, thymus, spleen, kidney, liver, small intestine, lung and peripheral blood leukocytes.