LDB1 Monoclonal antibody, PBS Only

• 

  WB analysis using 68721-1-Ig (same clone as 68721-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68721-1-Ig (LDB1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68721-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HSC-T6 using 68721-1-Ig (same clone as 68721-1-PBS)

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 68721-1-Ig (LDB1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68721-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 68721-1-Ig (same clone as 68721-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 68721-1-Ig (LDB1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68721-1-PBS in a different storage buffer formulation.

LDB1 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 68721-1-PBS

Clone No.2F11C3

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

WB, Indirect ELISA

Synonyms

CLIM 2, CLIM2, hLdb1, LDB 1, LDB1, LIM domain binding 1, LIM domain binding protein 1, NLI, Nuclear LIM interactor

---

Product Information

68721-1-PBS targets LDB1 in WB, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34563

  Product name: Recombinant human LDB1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-211 aa of BC000482

  Sequence: MLDRDVGPTPMYPPTYLEPGIGRHTPYGNQTDYRIFELNKRLQNWTEECDNLWWDAFTTEFFEDDAMLTITFCLEDGPKRYTIGRTLIPRYFRSIFEGGATELYYVLKHPKEAFHSNFVSLDCDQGSMVTQHGKPMFTQVCVEGRLYLEFMFDDMMRIKTWHFSIRQHRELIPRSILAMHAQDPQMLDQLSKNITRCGLSNSTLNYLRLCVI

• Full Name: LIM domain binding 1
• Calculated Molecular Weight: 46 kDa
• GenBank Accession Number: BC000482
• Gene Symbol: LDB1
• Gene ID (NCBI): 8861
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q86U70
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.