Use Able AI chat for product recommendations

LDLR Recombinant monoclonal antibody

LDLR Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 82724-1-RR
Clone No.1O11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA, Blocking assay

1O11, FH, FHC, LDL receptor

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, mouse liver tissue, rat liver tissue
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

82724-1-RR targets LDLR in WB, IHC, IF/ICC, ELISA, Blocking assay applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1236

Product name: Recombinant human LDLR protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-350 aa of BC014514

Sequence: MGPWGWKLRWTVALLLAAAGTAVGDRCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETCLSVTCKSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSDEQGCPPKTCSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCLSGECIHSSWRCDGGPDCKDKSDEENCAVATCRPDEFQCSDGNCIHGSRQCDREYDCKDMSDEVGCVNVTLCEGPNKFKCHSGECITLDKVCNMARDCRDWSDEPIKECGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQR

Predict reactive species
Full Name low density lipoprotein receptor
Calculated Molecular Weight 95 kDa
Observed Molecular Weight100-160 kDa
GenBank Accession NumberBC014514
Gene Symbol LDLR
Gene ID (NCBI) 3949
ENSEMBL Gene IDENSG00000130164
RRIDAB_3086519
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP01130
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LDLR (low density lipoprotein receptor) is a member of the LDL receptor gene family and is involved in receptor-mediated endocytosis of specific ligands. The LDLR is a cell surface glycoprotein that scavenges LDL from the blood and regulates plasma LDL cholesterol. The cytoplasmic domain of the LDL receptor is necessary for the receptor to cluster in coated pits, which promotes the rapid endocytosis of bound LDL. The protein is highly glycosylated through N- and O-linkages and thus migrates at 100 to 160 kDa bands on SDS-PAGE.

Protocols

Product Specific Protocols
IF protocol for LDLR antibody 82724-1-RRDownload protocol
IHC protocol for LDLR antibody 82724-1-RRDownload protocol
WB protocol for LDLR antibody 82724-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouse,humanWB

Invest Ophthalmol Vis Sci

Effects of Cholesterol Metabolism on Corneal Endothelial Dysfunction in Patients With Type 1 Diabetes

Authors - Zhichao Ren
humanWB

ACS Nano

Role of Serum Stability and Lipoprotein Interactions in Lipid Structure-Tumor Accumulation Relationship

Authors - Ashlynn Barnes
rat,humanWB

Phytomedicine

Xia Ku Cao Paste restores intestinal microbiota homeostasis and improves hepatic metabolism disturbances to alleviate hyperlipidemia.

Authors - Zhonghua Du
mouseIF

J Neuroinflammation

APOE-mediated lipid transport prevents C1q-related synaptic loss after spinal cord injury via attenuating macrophage lipid stress.

Authors - Yersen Mulat
humanIF

Biol Pharm Bull

Development of Low-Density Lipoprotein Receptor-Targeted Liposomes for Enhanced Accumulation in Ischemia/Reperfusion Environment.

Authors - Shintaro Yoneda
humanBlocking assay

Int J Pharm

Recombinant ApoE3 corona plus sucrose vitrification endows mRNA-LNPs with Freeze-Thaw and -80 °C stability.

Authors - Sai-Ning Tian

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Ioana (Verified Customer) (08-28-2025)

It worked very well for immunofluorescence, allowing colocalization with early endosomal markets.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:250
  • Cell Tissue Type: HeLaM
Loading...
||
New chat

Able

正在加载,请稍候...