LELP1 Polyclonal antibody

• 

  WB analysis using 32483-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32483-1-AP (LELP1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

LELP1 Polyclonal Antibody for WB, ELISA

Cat No. 32483-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, ELISA

Synonyms

Late cornified envelope-like proline-rich protein 1, Novel small proline-rich protein

---

Tested Applications

• Positive WB detected in: human testis tissue, rat testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:5000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32483-1-AP targets LELP1 in WB, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36831

  Product name: Recombinant human LELP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-98 aa of BC130507

  Sequence: MSSDDKSKSNDPKTEPKNCDPKCEQKCESKCQPSCLKKLLQRCFEKCPWEKCPAPPKCLPCPSQSPSSCPPQPCTKPCPPKCPSSCPHACPPPCPPPE

• Full Name: late cornified envelope-like proline-rich 1
• Calculated Molecular Weight: 11 kDa
• Observed Molecular Weight: 17 kDa
• GenBank Accession Number: BC130507
• Gene Symbol: LELP1
• Gene ID (NCBI): 149018
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q5T871
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Late cornified envelope-like proline-rich protein 1 (LELP1) is part of the epidermal differentiation complex (EDC), a cluster of genes that encode proteins essential for the differentiation of keratinocytes and the formation of the stratum corneum (PMID: 34112911). A single nucleotide polymorphism (SNP) in the LELP1 gene has been associated with atopic dermatitis, a chronic inflammatory skin disorder characterized by elevated levels of serum immunoglobulin E (IgE) and severe skin inflammation (PMID: 26608070).