LEPROT Polyclonal antibody

• 

  WB analysis using 20304-1-AP

  pig heart tissue was subjected to SDS PAGE followed by western blot with 20304-1-AP (LEPROT antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

LEPROT Polyclonal Antibody for WB, ELISA

Cat No. 20304-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, pig

Applications

WB, ELISA

Synonyms

LEPR, LEPROT, OB R gene related protein, OB RGRP, OBR, OBRGRP, VPS55

---

Tested Applications

• Positive WB detected in: pig heart tissue

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20304-1-AP targets LEPROT in WB, ELISA applications and shows reactivity with human, pig samples.

• Tested Reactivity: human, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14126

  Product name: Recombinant human LEPROT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 12-74 aa of BC011027

  Sequence: GLTFLMLGCALEDYGVYWPLFVLIFHAISPIPHFIAKRVTYDSDATSSACRELAYFFTTGIVV

• Full Name: leptin receptor overlapping transcript
• Calculated Molecular Weight: 131 aa, 14 kDa
• Observed Molecular Weight: 16 kDa
• GenBank Accession Number: BC011027
• Gene Symbol: LEPROT
• Gene ID (NCBI): 54741
• RRID: AB_2878667
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15243
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.