Tested Applications
| Positive WB detected in | BGC-823 cells, mouse brain tissue, HEK-293 cells, SGC-7901 cells, SKOV-3 cells, rat brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
Product Information
30007-1-AP targets LGR5 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag31625 Product name: Recombinant human LGR5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 824-907 aa of BC096324 Sequence: NPHFKEDLVSLRKQTYVWTRSKHPSLMSINSDDVEKQSCDSTQALVTFTSSSITYDLPPSSVPSPAYPVTESCHLSSVAFVPCL Predict reactive species |
| Full Name | leucine-rich repeat-containing G protein-coupled receptor 5 |
| Calculated Molecular Weight | 907 aa, 100 kDa |
| Observed Molecular Weight | 100 kDa |
| GenBank Accession Number | BC096324 |
| Gene Symbol | LGR5 |
| Gene ID (NCBI) | 8549 |
| RRID | AB_3086207 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O75473 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Leucine-rich repeat-containing G-protein coupled receptor 5 (LGR5) also known as G-protein coupled receptor 49 (GPR49) or G-protein coupled receptor 67 (GPR67) is a protein that in humans is encoded by the LGR5 gene. It is a member of GPCR class A receptor proteins. R-spondin proteins are the biological ligands of LGR5. LGR5 is expressed across a diverse range of tissue such as in the muscle, placenta, spinal cord and brain and particularly as a biomarker of adult stem cells in certain tissues.LGR5 is crucial during embryogenesis as LGR null studies in mice incurred 100% neonatal mortality accompanied by several craniofacial distortions such as ankyloglossia and gastrointestinal dilation (PMID: 9642114, 16575208, 525477).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for LGR5 antibody 30007-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Burns Trauma Nocardia rubra cell-wall skeleton mitigates whole abdominal irradiation-induced intestinal injury via regulating macrophage function | ||
Zool Res Peptide Cy RL-QN15 accelerates hair regeneration in diabetic mice by binding to the Frizzled-7 receptor | ||
Genome Med EMB is essential for enteric nervous system development mediated by PI3K signaling | ||
Cancer Lett Cancer Associated Fibroblasts-derived Lactate Induces Oxaliplatin Treatment Resistance by Promoting Cancer Stemness via ANTXR1 Lactylation in Colorectal Cancer | ||
Acta Histochem Stimulation of mouse hair regrowth by exosomes derived from human umbilical cord mesenchymal stem cells | ||
Int J Biol Macromol Integrated bulk and single-cell RNA sequencing unveils the temporal and spatial dynamics of epidermal cell adhesion |



