Tested Applications
| Positive WB detected in | HUVEC cells, human brain tissue, mouse testis tissue, HeLa cells, LNCaP cells, PC-3 cells |
| Positive IHC detected in | human testis tissue, human spleen tissue, human ovary tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 5 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
| ELISA | See 1 publications below |
Product Information
17658-1-AP targets LGR6 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag11909 Product name: Recombinant human LGR6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC047905 Sequence: MGRPRLTLVCQVSIIISARDLSMNNLTELQPGLFHHLRFLEELRLSGNHLSHIPGQAFSGLYSLKILMLQNNQLGGIPAEALWELPSLQSLRLDANLISLVPERSFEGLSSLRHLWLDDNALTEIPVRALNNLPALQAMTLALNRISHIPDYAFQNLTSLVVLHLHNNRIQHLGTHSFEGLHNLETLDLNYNKLQEFPVAIRTLGRLQELGFHNNNIKAIPEKAFMGNPLLQTIHFYDNPIQFVGRSAFQYLPKLHTLSLNGAMDIQEFPDLKGTTSLEILTLTRAGIRLLPSGMCQQLPRLRVLELSHNQIEELPSLHRCQKLEEIGLQHNRIWEIGADTFSQLSSLQAL Predict reactive species |
| Full Name | leucine-rich repeat-containing G protein-coupled receptor 6 |
| Calculated Molecular Weight | 915 aa, 99 kDa |
| Observed Molecular Weight | 104 kDa |
| GenBank Accession Number | BC047905 |
| Gene Symbol | LGR6 |
| Gene ID (NCBI) | 59352 |
| RRID | AB_2135163 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9HBX8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
LGR6 (Leucine-rich repeat-containing G-protein coupled receptor 6) is a seven-transmembrane protein. LGR6 is a high affinity receptor of R-spondins that potentiates the canonical Wnt signaling pathway and acts as a marker of multipotent stem cells in the epidermis. It potentially functions as a tumor suppressor. (PMID: 20223988; 20417836; 22615920)
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for LGR6 antibody 17658-1-AP | Download protocol |
| IHC protocol for LGR6 antibody 17658-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Clin Invest Maresin 1 activates LGR6 receptor promoting phagocyte immunoresolvent functions.
| ||
Int J Biol Macromol Study on the mechanism of macrophages activated by phosphoesterified rehmanniae polysaccharide on human gastric cancer cells | ||
Mol Ther Oncolytics Silencing LGR6 Attenuates Stemness and Chemoresistance via Inhibiting Wnt/β-Catenin Signaling in Ovarian Cancer. | ||
Proc Natl Acad Sci U S A The Maresin 1-LGR6 axis decreases respiratory syncytial virus-induced lung inflammation |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Marc (Verified Customer) (02-14-2023) | Used this antibody on immunofluorescence, but the expression of LGR6 in the spinal cord is low so we had to perform an immunofluorescence with tyramide amplification. With tyramide amplification the result is satisfactory.
|



















