LGR6 Polyclonal antibody, PBS Only

• 

  WB analysis of HUVEC using 17658-1-AP (same clone as 17658-1-PBS)

  HUVEC cells were subjected to SDS PAGE followed by western blot with 17658-1-AP (LGR6 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17658-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse testis using 17658-1-AP (same clone as 17658-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 17658-1-AP (LGR6 antibody) at dilution of 1:100 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17658-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 17658-1-AP (same clone as 17658-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 17658-1-AP (LGR6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17658-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 17658-1-AP (same clone as 17658-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 17658-1-AP (LGR6 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17658-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 17658-1-AP (same clone as 17658-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 17658-1-AP (LGR6 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 17658-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 17658-1-AP (same clone as 17658-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 17658-1-AP (LGR6 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 17658-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human spleen using 17658-1-AP (same clone as 17658-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen using 17658-1-AP (LGR6 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 17658-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human spleen using 17658-1-AP (same clone as 17658-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen using 17658-1-AP (LGR6 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 17658-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary using 17658-1-AP (same clone as 17658-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary using 17658-1-AP (LGR6 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 17658-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary using 17658-1-AP (same clone as 17658-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary using 17658-1-AP (LGR6 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 17658-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

LGR6 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 17658-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

VTS20631, UNQ6427/PRO21331, Leucine-rich repeat-containing G-protein coupled receptor 6, GPCR

---

Product Information

17658-1-PBS targets LGR6 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11909

  Product name: Recombinant human LGR6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-351 aa of BC047905

  Sequence: MGRPRLTLVCQVSIIISARDLSMNNLTELQPGLFHHLRFLEELRLSGNHLSHIPGQAFSGLYSLKILMLQNNQLGGIPAEALWELPSLQSLRLDANLISLVPERSFEGLSSLRHLWLDDNALTEIPVRALNNLPALQAMTLALNRISHIPDYAFQNLTSLVVLHLHNNRIQHLGTHSFEGLHNLETLDLNYNKLQEFPVAIRTLGRLQELGFHNNNIKAIPEKAFMGNPLLQTIHFYDNPIQFVGRSAFQYLPKLHTLSLNGAMDIQEFPDLKGTTSLEILTLTRAGIRLLPSGMCQQLPRLRVLELSHNQIEELPSLHRCQKLEEIGLQHNRIWEIGADTFSQLSSLQAL

• Full Name: leucine-rich repeat-containing G protein-coupled receptor 6
• Calculated Molecular Weight: 915 aa, 99 kDa
• Observed Molecular Weight: 104 kDa
• GenBank Accession Number: BC047905
• Gene Symbol: LGR6
• Gene ID (NCBI): 59352
• RRID: AB_2135163
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HBX8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

LGR6 (Leucine-rich repeat-containing G-protein coupled receptor 6) is a seven-transmembrane protein. LGR6 is a high affinity receptor of R-spondins that potentiates the canonical Wnt signaling pathway and acts as a marker of multipotent stem cells in the epidermis. It potentially functions as a tumor suppressor. (PMID: 20223988; 20417836; 22615920)