Product Information
21005-1-PBS targets LHFPL1 in IHC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15208 Product name: Recombinant human LHFPL1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 137-187 aa of BC100786 Sequence: YCAGGGAAAAMLICTWLSCFAGRNPKPVILVESIMRNTNSYAMELDHCLKP Predict reactive species |
| Full Name | lipoma HMGIC fusion partner-like 1 |
| Calculated Molecular Weight | 220 aa, 24 kDa |
| GenBank Accession Number | BC100786 |
| Gene Symbol | LHFPL1 |
| Gene ID (NCBI) | 340596 |
| RRID | AB_3085631 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q86WI0 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |



