Filter: AllIHC

IHC staining of human placenta using 21005-1-AP (same clone as 21005-1-PBS)
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 21005-1-AP (LHFPL1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21005-1-PBS in a different storage buffer formulation.
IHC staining of human placenta using 21005-1-AP (same clone as 21005-1-PBS)
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 21005-1-AP (LHFPL1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21005-1-PBS in a different storage buffer formulation.

LHFPL1 Polyclonal antibody, PBS Only

Name: LHFPL1 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 21005-1-PBS

LHFPL1 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 21005-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

21005-1-PBS targets LHFPL1 in IHC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag15208 Product name: Recombinant human LHFPL1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 137-187 aa of BC100786 Sequence: YCAGGGAAAAMLICTWLSCFAGRNPKPVILVESIMRNTNSYAMELDHCLKP Predict reactive species
Full Name	lipoma HMGIC fusion partner-like 1
Calculated Molecular Weight	220 aa, 24 kDa
GenBank Accession Number	BC100786
Gene Symbol	LHFPL1
Gene ID (NCBI)	340596
RRID	AB_3085631
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q86WI0
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Able™