Product Information
24557-1-AP targets LHFPL2 in ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18868 Product name: Recombinant human LHFPL2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 23-101 aa of BC136336 Sequence: AELIAFMSADWLIGKARSRGGVEPAGPGGGSPEPYHPTLGIYARCIRNPGVQHFQRDTLCGPYAESFGEIASGFWQATA Predict reactive species |
| Full Name | lipoma HMGIC fusion partner-like 2 |
| Calculated Molecular Weight | 228 aa, 24 kDa |
| GenBank Accession Number | BC136336 |
| Gene Symbol | LHFPL2 |
| Gene ID (NCBI) | 10184 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q6ZUX7 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
