DNA ligase III/LIG3 Monoclonal antibody, PBS Only (Capture)

DNA ligase III/LIG3 Monoclonal Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 68810-1-PBS
Clone No.1B10B3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, Cytometric bead array, Indirect ELISA

LIG3, 1B10B3, DNA ligase 3, DNA ligase III, EC:6.5.1.1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68810-1-PBS targets DNA ligase III/LIG3 as part of a matched antibody pair:

MP50683-2: 68810-1-PBS capture and 68810-3-PBS detection (validated in Cytometric bead array)

MP50683-3: 68810-1-PBS capture and 68810-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag31484

Product name: Recombinant human LIG3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 254-390 aa of BC068005

Sequence: CDPRHKDCLLREFRKLCAMVADNPSYNTKTQIIQDFLRKGSAGDGFHGDVYLTVKLLLPGVIKTVYNLNDKQIVKLFSRIFNCNPDDMARDLEQGDVSETIRVFFEQSKSFPPAAKSLLTIQEVDEFLLRLSKLTKE

Predict reactive species
Full Name ligase III, DNA, ATP-dependent
Calculated Molecular Weight 100-110 kDa
Observed Molecular Weight 100 kDa
GenBank Accession NumberBC068005
Gene Symbol LIG3
Gene ID (NCBI) 3980
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP49916
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

DNA ligase III (DNA ligase 3) is an enzyme that in humans is encoded by the LIG3 gene. The human LIG3 gene encodes ATP-dependent DNA ligases that seal interruptions in the phosphodiester backbone of duplex DNA. There are three families of ATP-dependent DNA ligases in eukaryotes. These enzymes utilize the same three step reaction mechanism; 1 formation of a covalent enzyme-adenylate intermediate; 2 transfer of the adenylate group to the 5' phosphate terminus of a DNA nick; 3 phosphodiester bond formation. Unlike LIG1 and LIG4 family members that are found in almost all eukaryotes, LIG3 family members are less widely distributed. The LIG3 gene encodes several distinct DNA ligase species by alternative translation initiation and alternative splicing mechanisms.

Loading...
||
New chat

Able

正在加载,请稍候...