Anti-Human LILRA2/CD85h Rabbit Recombinant Antibody

• 

  FC experiment of human peripheral blood leukocytes using 98607-1-RR

  1x10^6 human peripheral blood leukocytes were surface stained with 0.25 ug Anti-Human LILRA2/CD85h Rabbit RecAb (98607-1-RR, Clone:250334G1) or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed.

• 

  FC experiment of human peripheral blood leukocytes using 98607-1-RR

  1x10^6 human peripheral blood leukocytes were surface stained with 0.25 ug Anti-Human LILRA2/CD85h Rabbit RecAb (98607-1-RR, Clone:250334G1)(red) or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9)(blue) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed.

• 

  Affinity of 98607-1-RR

  Biolayer interferometry (BLl) kinetic assays of 98607-1-RR against Human LILRA2/CD85h were performed. The affinity constant is below 1 pM.

LILRA2/CD85h Uni-rAb^® Recombinant Antibody for FC

Cat No. 98607-1-RR

Clone No.250334G1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

LILRA2, CD85 antigen-like family member H, CD85h, ILT 1, ILT1

---

Tested Applications

• Positive FC detected in: FC receptor blocked human peripheral blood leukocytes

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98607-1-RR targets LILRA2/CD85h in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1746

  Product name: Recombinant Human LILRA2 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 24-449 aa of NM_001130917.3

  Sequence: GHLPKPTLWAEPGSVIIQGSPVTLRCQGSLQAEEYHLYRENKSASWVRRIQEPGKNGQFPIPSITWEHAGRYHCQYYSHNHSSEYSDPLELVVTGAYSKPTLSALPSPVVTSGGNVTLQCVSQVAFDGFILCKEGEDEHPQRLNSHSHARGWSWAIFSVGPVSPSRRWSYRCYAYDSNSPYVWSLPSDLLELLVPGVSKKPSLSVQPGPMVAPGESLTLQCVSDVGYDRFVLYKEGERDFLQRPGWQPQAGLSQANFTLGPVSPSHGGQYRCYSAHNLSSEWSAPSDPLDILITGQFYDRPSLSVQPVPTVAPGKNVTLLCQSRGQFHTFLLTKEGAGHPPLHLRSEHQAQQNQAEFRMGPVTSAHVGTYRCYSSLSSNPYLLSLPSDPLELVVSEAAETLSPSQNKTDSTTTSLGQHPQDYTVEN

• Full Name: leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 2
• Calculated Molecular Weight: 53kDa
• GenBank Accession Number: NM_001130917.3
• Gene Symbol: LILRA2
• Gene ID (NCBI): 11027
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8N149-1
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

LILRA2 (Leukocyte Immunoglobulin-Like Receptor A2) is a specialized cell surface receptor primarily expressed on innate immune cells. It functions as a sensor for specific microbial products and plays a complex role in regulating immune responses. LILRA2 selectively modulates LPS-mediated responses in monocytes, enhancing production of specific pro-inflammatory cytokines while inhibiting phagocytosis (PMID 22479404).