LIMCH1 Polyclonal antibody

• 

  WB analysis using 26561-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26561-1-AP (LIMCH1 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 26561-1-AP

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 26561-1-AP (LIMCH1 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

LIMCH1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26561-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

LMO7B, LIMCH1A, LIM and calponin homology domains-containing protein 1, KIAA1102

---

Tested Applications

• Positive WB detected in: HeLa cells, mouse brain tissue
• Positive IHC detected in: human intrahepatic cholangiocarcinoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26561-1-AP targets LIMCH1 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24112

  Product name: Recombinant human LIMCH1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 211-566 aa of BC023546

  Sequence: RWKSRRRSVSQDLIKKEEERKKMEKLLAGEDGTSERRKSIKTYREIVQEKERRERELHEAYKNARSQEEAEGILQQYIERFTISEAVLERLEMPKILERSHSTEPNLSSFLNDPNPMKYLRQQSLPPPKFTATVETTIARASVLDTSMSAGSGSPSKTVTPKAVPMLTPKPYSQPKNSQDVLKTFKVDGKVSVNGETVHREEEKERECPTVAPAHSLTKSQMFEGVARVHGSPLELKQDNGSIEINIKKPNSVPQELAATTEKTEPNSQEDKNDGGKSRKGNIELASSEPQHFTTTVTRCSPTVAFVEFPSSPQLKNDVSEEKDQKKPENEMSGKVELVLSQKVVKPKSPEPEATL

• Full Name: LIM and calponin homology domains 1
• Observed Molecular Weight: ~150 kDa
• GenBank Accession Number: BC023546
• Gene Symbol: LIMCH1
• Gene ID (NCBI): 22998
• RRID: AB_3085883
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UPQ0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LIM and calponin-homology domains 1 (LIMCH1) was identified from a border cell migration screen based on conditional ectopic expression in Drosophila. It's a kind of actin stress fibers-associated protein that activates non-muscle myosin IIa. Through the activation of non-muscle myosin IIa, LIMCH1 positively regulates actin stress fibers assembly and stabilizes focal adhesions, negatively regulates cell spreading and cell migration.