LIV-1/ZIP6 Polyclonal antibody, PBS Only

• 

  WB analysis of HeLa using 14236-1-AP (same clone as 14236-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 14236-1-AP (LIV-1/ZIP6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14236-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 14236-1-AP (same clone as 14236-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14236-1-AP (LIV-1/ZIP6 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14236-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 14236-1-AP (same clone as 14236-1-PBS)

  WB result of LIV-1/ZIP6 antibody (14236-1-AP; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-LIV-1/ZIP6 transfected HeLa cells. This data was developed using the same antibody clone with 14236-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 14236-1-AP (same clone as 14236-1-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 14236-1-AP (LIV-1/ZIP6 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14236-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 14236-1-AP (same clone as 14236-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 14236-1-AP (LIV-1/ZIP6 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14236-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 14236-1-AP (same clone as 14236-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 14236-1-AP (LIV-1/ZIP6 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14236-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

LIV-1/ZIP6 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 14236-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

LIV 1, SLC39A6, ZIP6, Estrogen-regulated protein LIV-1, LIV1

---

Product Information

14236-1-PBS targets LIV-1/ZIP6 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5478

  Product name: Recombinant human SLC39A6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 101-283 aa of BC039498

  Sequence: HLLPHSHASHHHSHSHEEPAMEMKRGPLFSHLSSQNIEESAYFDSTWKGLTALGGLYFMFLVEHVLTLIKQFKDKKKKNQKKPENDDDVEIKKQLSKYESQLSTNEEKVDTDDRTEGYLRADSQEPSHFDSQQPAVLEEEEVMIAHAHPQEVYNEYVPRGCKNKCHSHFHDTLGQSDDLIHHH

• Full Name: solute carrier family 39 (zinc transporter), member 6
• Calculated Molecular Weight: 85 kDa
• Observed Molecular Weight: 85-100 kDa, 48 and 32 kDa
• GenBank Accession Number: BC039498
• Gene Symbol: SLC39A6/ZIP6
• Gene ID (NCBI): 25800
• RRID: AB_10596924
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13433
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The zinc transporter LIV-1 (also known as SLC39A6 or ZIP6) was originally identified as an estrogen-induced gene in breast cancer cells. Elevated LIV-1 expression is reportedly related to cancer progression in various types of cancer, including breast, prostate, pancreatic, cervical and liver cancers. While correlation of LIV-1 and prognosis may vary. LIV 1 has 3 isoforms with MW of 85-100 (glycosylation and phosphorylation), 48 and 32 kDa while migrates as different bands in different lysates in SDS-PAGE.