• Featured Product
  • KD/KO Validated

SLC39A6/ZIP6 Polyclonal antibody, PBS Only

SLC39A6/ZIP6 Polyclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 14236-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

LIV 1, LIV-1/ZIP6, SLC39A6, ZIP6, Estrogen-regulated protein LIV-1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

14236-1-PBS targets SLC39A6/ZIP6 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5478

Product name: Recombinant human SLC39A6 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 101-283 aa of BC039498

Sequence: HLLPHSHASHHHSHSHEEPAMEMKRGPLFSHLSSQNIEESAYFDSTWKGLTALGGLYFMFLVEHVLTLIKQFKDKKKKNQKKPENDDDVEIKKQLSKYESQLSTNEEKVDTDDRTEGYLRADSQEPSHFDSQQPAVLEEEEVMIAHAHPQEVYNEYVPRGCKNKCHSHFHDTLGQSDDLIHHH

Predict reactive species
Full Name solute carrier family 39 (zinc transporter), member 6
Calculated Molecular Weight 85 kDa
Observed Molecular Weight 85-103 kDa, 48 and 32 kDa
GenBank Accession NumberBC039498
Gene Symbol SLC39A6/ZIP6
Gene ID (NCBI) 25800
RRIDAB_10596924
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ13433
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The zinc transporter LIV-1 (also known as SLC39A6 or ZIP6) was originally identified as an estrogen-induced gene in breast cancer cells. Elevated LIV-1 expression is reportedly related to cancer progression in various types of cancer, including breast, prostate, pancreatic, cervical and liver cancers. While correlation of LIV-1 and prognosis may vary. LIV 1 has 3 isoforms with MW of 85-100 (glycosylation and phosphorylation), 48 and 32 kDa while migrates as different bands in different lysates in SDS-PAGE. Furthermore, it has been reported in the papers that full-length SLC39A6/ZIP6, as the pro-protein, is predicted to be 85 kDa and produces a 103 kDa band, the N-terminal fragment after cleavage is 35 kDa, and the cleaved ZIP6 is 68 kDa (PMID: 23919497, PMID: 26444413).

Loading...
||
New chat

Able

正在加载,请稍候...