LIV-1/ZIP6 Polyclonal antibody

• 

  WB analysis using 14236-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14236-1-AP (LIV-1/ZIP6 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 14236-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 14236-1-AP (LIV-1/ZIP6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 14236-1-AP

  WB result of LIV-1/ZIP6 antibody (14236-1-AP; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-LIV-1/ZIP6 transfected HeLa cells.

• 

  WB analysis of MCF-7 using 14236-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 14236-1-AP (LIV-1/ZIP6 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human pancreas cancer using 14236-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 14236-1-AP (LIV-1/ZIP6 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pancreas cancer using 14236-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 14236-1-AP (LIV-1/ZIP6 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

LIV-1/ZIP6 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 14236-1-AP

Publications(11)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

Ermelin, LIV 1, LIV1, LIV-1/ZIP6, SLC39A6, Zinc transporter ZIP6, ZIP 6, ZIP6, Zrt and Irt like protein 6

---

Tested Applications

• Positive WB detected in: HeLa cells, MCF-7 cells, A549 cells, 4T1 cells
• Positive IHC detected in: human pancreas cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 4 publications below
• WB: See 9 publications below
• IHC: See 4 publications below
• IF: See 3 publications below

Product Information

14236-1-AP targets LIV-1/ZIP6 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, zebrafish
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5478

  Product name: Recombinant human SLC39A6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 101-283 aa of BC039498

  Sequence: HLLPHSHASHHHSHSHEEPAMEMKRGPLFSHLSSQNIEESAYFDSTWKGLTALGGLYFMFLVEHVLTLIKQFKDKKKKNQKKPENDDDVEIKKQLSKYESQLSTNEEKVDTDDRTEGYLRADSQEPSHFDSQQPAVLEEEEVMIAHAHPQEVYNEYVPRGCKNKCHSHFHDTLGQSDDLIHHH

• Full Name: solute carrier family 39 (zinc transporter), member 6
• Calculated Molecular Weight: 85 kDa
• Observed Molecular Weight: 85-100 kDa, 48 and 32 kDa
• GenBank Accession Number: BC039498
• Gene Symbol: SLC39A6/ZIP6
• Gene ID (NCBI): 25800
• RRID: AB_10596924
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13433
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The zinc transporter LIV-1 (also known as SLC39A6 or ZIP6) was originally identified as an estrogen-induced gene in breast cancer cells. Elevated LIV-1 expression is reportedly related to cancer progression in various types of cancer, including breast, prostate, pancreatic, cervical and liver cancers. While correlation of LIV-1 and prognosis may vary. LIV 1 has 3 isoforms with MW of 85-100 (glycosylation and phosphorylation), 48 and 32 kDa while migrates as different bands in different lysates in SDS-PAGE.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	Nat Genet; Genome-wide association study identifies common variants in SLC39A6 associated with length of survival in esophageal squamous-cell carcinoma.; Authors - Wu Chen C ; KD Validated
human	WB	Gastroenterology; Solute Carrier Family 39 Member 6 Gene Promotes Aggressiveness of Esophageal Carcinoma Cells by Increasing Intracellular Levels of Zinc, Activating Phosphatidylinositol 3-Kinase Signaling, and Up-regulating Genes That Regulate Metastasis.; Authors - Xinxin Cheng ; KD Validated
human	WB	Oncotarget; miR-192, a prognostic indicator, targets the SLC39A6/SNAIL pathway to reduce tumor metastasis in human hepatocellular carcinoma.; Authors - Junwei Lian
human	WB	Talanta; DNA aptamer targeting zinc transporters ZIP10 and ZIP6 on cancer cells; Authors - Zhenhao Long
human	WB,IF	Oncotarget; Co-expression analysis revealed PTCH1-3'UTR promoted cell migration and invasion by activating miR-101-3p/SLC39A6 axis in non-small cell lung cancer: implicating the novel function of PTCH1.; Authors - Xuechao Wan ; KD Validated
human	WB, IHC	J Transl Med; SLC39A6: a potential target for diagnosis and therapy of esophageal carcinoma.; Authors - Xiao-Bin Cui