LMO1 Polyclonal antibody

• 

  WB analysis of mouse brain using 26932-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 26932-1-AP (LMO1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 26932-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26932-1-AP (LMO1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

LMO1 Polyclonal Antibody for WB, ELISA

Cat No. 26932-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Cysteine rich protein TTG 1, LIM domain only protein 1, LMO 1, LMO1, RBTN1, RHOM1, Rhombotin 1, T cell translocation protein 1, TTG1

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26932-1-AP targets LMO1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25607

  Product name: Recombinant human LMO1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 11-83 aa of BC069793

  Sequence: PMLSVQPKGKQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFG

• Full Name: LIM domain only 1 (rhombotin 1)
• Calculated Molecular Weight: 18 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC069793
• Gene Symbol: LMO1
• Gene ID (NCBI): 4004
• RRID: AB_3085916
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P25800
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LOM1 (LIM Domain Only 1), as a Protein Coding gene, encodes a cysteine-rich, two LIM domain transcriptional regulator. It may be involved in gene regulation within neural lineage cells potentially by direct DNA binding or by binding to other transcription factors. A chromosomal aberration involving LMO1 may be a cause of a form of T-cell acute lymphoblastic leukemia (T-ALL)(Uniprot). Diseases associated with LMO1 include T-Cell Acute Lymphoblastic Leukemia and Neuroblastoma (PMID:31830377). The downstream of LMO1-regulatory cascade includes a tumor-promoting LIMS1/ILK pathway, which has a potential to be a novel therapeutic target(PMID: 29695398). The molecular weight of LMO1 is 18 kDa.