LOXL1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86534-2-RR (same clone as 86534-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86534-2-RR (LOXL1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86534-2-PBS in a different storage buffer formulation.

• 

  IF Staining of U-87 MG using 86534-2-RR (same clone as 86534-2-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed U-87 MG cells using LOXL1 antibody (86534-2-RR, Clone: 251345E7 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 86534-2-PBS in a different storage buffer formulation.

LOXL1 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 86534-2-PBS

Clone No.251345E7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

EC:1.4.3.13, LOL, LOXL, LOXL 1, LOXL-1

---

Product Information

86534-2-PBS targets LOXL1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag24293

  Product name: Recombinant human LOXL1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 283-366 aa of BC015090

  Sequence: TPGFEQAYPDPGPEAAQAHGGDPRLGWYPPYANPPPEAYGPPRALEPPYLPVRSSDTPPPGGERNGAQQGRLSVGSVYRPNQNG

• Full Name: lysyl oxidase-like 1
• Calculated Molecular Weight: 63 kDa
• Observed Molecular Weight: 60-63 kDa
• GenBank Accession Number: BC015090
• Gene Symbol: LOXL1
• Gene ID (NCBI): 4016
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q08397
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Three LOXL1 variants are seen: a band of 64 kDa matching the predicted full-length form lacking the secretory signal peptide, a band of 67 kDa presumed to be the full-length form with the signal peptide, and a band of 36 kDa matching the cleavage product.