Tested Applications
| Positive WB detected in | Jurkat cells, A375 cells, HeLa cells, mouse brain tissue, multi-cells/tissue, A549 cells, A2780 cells, NIH3T3 cells |
| Positive IHC detected in | human brain tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive FC (Intra) detected in | Jurkat cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:300-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 5 publications below |
| IHC | See 1 publications below |
Product Information
20442-1-AP targets EDG2/LPA1 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14253 Product name: Recombinant human LPAR1,EDG2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 305-364 aa of BC030615 Sequence: AMNPIIYSYRDKEMSATFRQILCCQRSENPTGPTEGSDRSASSLNHTILAGVHSNDHSVV Predict reactive species |
| Full Name | lysophosphatidic acid receptor 1 |
| Calculated Molecular Weight | 364 aa, 41 kDa |
| Observed Molecular Weight | 41-50 kDa |
| GenBank Accession Number | BC030615 |
| Gene Symbol | EDG2 |
| Gene ID (NCBI) | 1902 |
| RRID | AB_11183048 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q92633 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
EDG2 (also known as LPA1) is a G-protein coupled receptor for lysophosphatidic acid (LPA), a potent motility inducing factor, which is a major component of serum (PMID: 19415462). EDG2 is widely expressed in normal tissue during growth and development. In the context of cancer, several studies have suggested that EDG2 expression in tumors is often similar to that shown in normal tissue (PMID: 17496233).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for EDG2/LPA1 antibody 20442-1-AP | Download protocol |
| IHC protocol for EDG2/LPA1 antibody 20442-1-AP | Download protocol |
| WB protocol for EDG2/LPA1 antibody 20442-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mediators Inflamm AM966, an Antagonist of Lysophosphatidic Acid Receptor 1, Increases Lung Microvascular Endothelial Permeability through Activation of Rho Signaling Pathway and Phosphorylation of VE-Cadherin. | ||
Cell Death Dis S1PR3-driven positive feedback loop sustains STAT3 activation and keratinocyte hyperproliferation in psoriasis | ||
Discov Oncol Glutamate activates the MAPK pathway by inhibiting LPAR1 expression and promotes anlotinib resistance in thyroid cancer | ||
J Control Release Mannose-modified exosomes loaded with MiR-23b-3p target alveolar macrophages to alleviate acute lung injury in Sepsis | ||
Pediatr Res Bronchopulmonary dysplasia demonstrates dysregulated autotaxin/lysophosphatidic acid signaling in a neonatal mouse model |



















