EDG2/LPA1 Polyclonal antibody

EDG2/LPA1 Polyclonal Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 20442-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, FC (Intra), ELISA

LPAR1, edg 2, EDG2, Gpcr26, GPR26

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, A375 cells, HeLa cells, mouse brain tissue, multi-cells/tissue, A549 cells, A2780 cells, NIH3T3 cells
Positive IHC detected inhuman brain tissue, mouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inJurkat cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:300-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

20442-1-AP targets EDG2/LPA1 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag14253

Product name: Recombinant human LPAR1,EDG2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 305-364 aa of BC030615

Sequence: AMNPIIYSYRDKEMSATFRQILCCQRSENPTGPTEGSDRSASSLNHTILAGVHSNDHSVV

Predict reactive species
Full Name lysophosphatidic acid receptor 1
Calculated Molecular Weight 364 aa, 41 kDa
Observed Molecular Weight 41-50 kDa
GenBank Accession NumberBC030615
Gene Symbol EDG2
Gene ID (NCBI) 1902
RRIDAB_11183048
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ92633
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EDG2 (also known as LPA1) is a G-protein coupled receptor for lysophosphatidic acid (LPA), a potent motility inducing factor, which is a major component of serum (PMID: 19415462). EDG2 is widely expressed in normal tissue during growth and development. In the context of cancer, several studies have suggested that EDG2 expression in tumors is often similar to that shown in normal tissue (PMID: 17496233).

Protocols

Product Specific Protocols
IHC protocol for EDG2/LPA1 antibody 20442-1-APDownload protocol
WB protocol for EDG2/LPA1 antibody 20442-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Mediators Inflamm

AM966, an Antagonist of Lysophosphatidic Acid Receptor 1, Increases Lung Microvascular Endothelial Permeability through Activation of Rho Signaling Pathway and Phosphorylation of VE-Cadherin.

Authors - Junting Cai
mouse,humanWB,IHC

Pediatr Res

Bronchopulmonary dysplasia demonstrates dysregulated autotaxin/lysophosphatidic acid signaling in a neonatal mouse model

Authors - Alison W Ha
humanWB

Cell Death Dis

S1PR3-driven positive feedback loop sustains STAT3 activation and keratinocyte hyperproliferation in psoriasis

Authors - Panpan Lian
mouseWB

J Control Release

Mannose-modified exosomes loaded with MiR-23b-3p target alveolar macrophages to alleviate acute lung injury in Sepsis

Authors - Jiezhi Lin
humanWB

Discov Oncol

Glutamate activates the MAPK pathway by inhibiting LPAR1 expression and promotes anlotinib resistance in thyroid cancer

Authors - Bin Liu
Loading...
||
New chat Able
正在加载,请稍候...