Published Applications
| WB | See 3 publications below |
| IHC | See 1 publications below |
Product Information
14668-1-AP targets LPCAT3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6329 Product name: Recombinant human LPCAT3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 122-233 aa of BC065194 Sequence: MAYLLAGYYYTATGNYDIKWTMPHCVLTLKLIGLAVDYFDGGKDQNSLSSEQQKYAIRGVPSLLEVAGFSYFYGAFLVGPQFSMNHYMKLVQGELIDIPGKIPNSIIPALKR Predict reactive species |
| Full Name | lysophosphatidylcholine acyltransferase 3 |
| Calculated Molecular Weight | 56 kDa |
| GenBank Accession Number | BC065194 |
| Gene Symbol | LPCAT3 |
| Gene ID (NCBI) | 10162 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q6P1A2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Publications
| Species | Application | Title |
|---|---|---|
Biochem Biophys Res Commun Matrine protects against experimental autoimmune encephalomyelitis through modulating microglial ferroptosis | ||
Heliyon Metabolomics reveals that ferroptosis participates in bisphenol A-induced testicular injury | ||
Ecotoxicol Environ Saf Dose-dependent effects of hydroquinone on liver injury and lipid dysregulation based on SCD1/AMPK signaling pathway in C57BL/6 mice |
