Product Information
60619-2-PBS targets LRP5 as part of a matched antibody pair:
MP50882-1: 60619-1-PBS capture and 60619-2-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20043 Product name: Recombinant human LRP5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1332-1397 aa of BC150595 Sequence: CDAICLPNQFRCASGQCVLIKQQCDSFPDCIDGSDELMCEITKPPSDDSPAHSSAIGPVIGIILSL Predict reactive species |
| Full Name | low density lipoprotein receptor-related protein 5 |
| Calculated Molecular Weight | 1615 aa, 179 kDa |
| GenBank Accession Number | BC150595 |
| Gene Symbol | LRP5 |
| Gene ID (NCBI) | 4041 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | O75197 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |

