LRRC18 Polyclonal antibody

• 

  WB analysis of mouse testis using 24571-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 24571-1-AP (LRRC18 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse testis using 24571-1-AP

  IP result of anti-LRRC18 (IP:24571-1-AP, 3ug; Detection:24571-1-AP 1:500) with mouse testis tissue lysate 4000ug.

• 

  IHC staining of human testis using 24571-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 24571-1-AP (LRRC18 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human testis using 24571-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 24571-1-AP (LRRC18 Antibody) at dilution of 1:50 (under 10x lens).

LRRC18 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 24571-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IP, IHC, ELISA

Synonyms

LRRC18, UNQ933, UNQ9338, VKGE9338

---

Tested Applications

• Positive WB detected in: mouse testis tissue
• Positive IP detected in: mouse testis tissue
• Positive IHC detected in: human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24571-1-AP targets LRRC18 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20996

  Product name: Recombinant human LRRC18 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-261 aa of BC036722

  Sequence: MVKGEKGPKGKKITLKVARNCIKITFDGKKRLDLSKMGITTFPKCILRLSDMDELDLSRNLIRKIPDSISKFQNLRWLDLHSNYIDKLPESIGQMTSLLYLNVSNNRLTSNGLPVELKQLKNIRAVNLGLNHLDSVSTTLGALKELHEVGLHDNLLNNIPVSISKLPKLKKLNIKRNPFPKPGESEIFIDSIRRLENLYVVEEKDLCAACLRKCQNARDNLNRIKNMATTTPRKTIFPNLISPNSMAKDSWEDWRIRLTSS

• Full Name: leucine rich repeat containing 18
• Calculated Molecular Weight: 261 aa, 30 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC036722
• Gene Symbol: LRRC18
• Gene ID (NCBI): 474354
• RRID: AB_2879614
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N456
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Leucine rich repeat containing protein 18 ( LRRC18 ) encodes a 261 amino-acids protein (29.6 kDa), which contains 7 leucine rich repeat and belongs to LRR superfamily. The function of protein is still non-known, but it may be involved in the regulation of spermatogenesis and sperm maturation. The protein localizes in cytoplasm and express in some male reproduction tissues.