Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells |
| Positive IHC detected in | mouse testis tissue, rat testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | NIH/3T3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:300-1:1200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15879-1-AP targets LSM3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8641 Product name: Recombinant human LSM3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-102 aa of BC007055 Sequence: MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVG Predict reactive species |
| Full Name | LSM3 homolog, U6 small nuclear RNA associated (S. cerevisiae) |
| Calculated Molecular Weight | 102 aa, 12 kDa |
| Observed Molecular Weight | 12 kDa |
| GenBank Accession Number | BC007055 |
| Gene Symbol | LSM3 |
| Gene ID (NCBI) | 27258 |
| RRID | AB_3669222 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P62310 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
LSM3, as a U6 snRNA-associated Sm-like protein, plays a role in pre-mRNA splicing as component of the U4/U6-U5 tri-snRNP complex that is involved in spliceosome assembly, and as component of the precatalytic spliceosome (spliceosome B complex)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for LSM3 antibody 15879-1-AP | Download protocol |
| IHC protocol for LSM3 antibody 15879-1-AP | Download protocol |
| WB protocol for LSM3 antibody 15879-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |











