LST1 Polyclonal antibody

• 

  WB analysis using 21361-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21361-1-AP (LST1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of THP-1 using 21361-1-AP

  WB result of LST1 antibody (21361-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-LST1 transfected THP-1 cells.

• 

  IHC staining of mouse brain using 21361-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 21361-1-AP (LST1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 21361-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 21361-1-AP (LST1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 21361-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using LST1 antibody (21361-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

LST1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 21361-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Protein B144, LST 1, Leukocyte-specific transcript 1 protein, D6S49E, B144

---

Tested Applications

• Positive WB detected in: THP-1 cells, mouse brain tissue, rat brain tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

21361-1-AP targets LST1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15817

  Product name: Recombinant human LST1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 7-66 aa of BC103856

  Sequence: VKRLERSWAQGSSEQELHYASLQRLPVPSSEGPDLRGRDKRGTKEDPRADYACIAENKPT

• Full Name: leukocyte specific transcript 1
• Calculated Molecular Weight: 97 aa, 11 kDa
• Observed Molecular Weight: 10-15 kDa
• GenBank Accession Number: BC103856
• Gene Symbol: LST1
• Gene ID (NCBI): 7940
• RRID: AB_2918071
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00453
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LST1 (Leukocyte Specific Transcript 1), also known as B144, is a small adaptor protein expressed in leukocytes of myeloid lineage. LST1 splice variants (LST1/A-LST1/N) have been detected in various cell types, and thought to affect mainly LST1 gene expression and splicing, are associated with inflammatory conditions(PMID: 10706707, PMID: 33986741). The molecular weight of LSTI protein may vary between different lysates.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Braz J Otorhinolaryngol; Significance of leukocyte-specific transcript 1 levels in nasal mucosal tissue to predict recurrence of nasal polyps; Authors - Junyi Zhang