LTBR Polyclonal antibody

• 

  WB analysis using 33655-1-AP

  Mouse LTBR Recombinant protein (Cat No.Eg6278) were subjected to SDS PAGE followed by western blot with 33655-1-AP (LTBR antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

LTBR Polyclonal Antibody for WB, ELISA

Cat No. 33655-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, ELISA

Synonyms

Lymphotoxin-beta receptor, Tnfcr, Tnfrsf3, Tumor necrosis factor receptor superfamily member 3

---

Tested Applications

• Positive WB detected in: Recombinant protein

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33655-1-AP targets LTBR in WB, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg6278

  Product name: Recombinant mouse LTBR/TNFRSF3 protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 31-223 aa of NM_010736

  Sequence: QLVPPYRIENQTCWDQDKEYYEPMHDVCCSRCPPGEFVFAVCSRSQDTVCKTCPHNSYNEHWNHLSTCQLCRPCDIVLGFEEVAPCTSDRKAECRCQPGMSCVYLDNECVHCEEERLVLCQPGTEAEVTDEIMDTDVNCVPCKPGHFQNTSSPRARCQPHTRCEIQGLVEAAPGTSYSDTICKNPPEPGAMLL

• Full Name: lymphotoxin B receptor
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: NM_010736
• Gene Symbol: Ltbr
• Gene ID (NCBI): 17000
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P50284
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Lymphotoxin-beta receptor (LTBR) is a receptor for the heterotrimeric lymphotoxin containing LTA and LTB, and for TNFS14/LIGHT. It can activate the NF-kappa-B signaling pathway upon stimulation with lymphotoxin (LTA1-LTB2) (PMID: 24248355). LTBR is constitutively expressed on stromal cells and myeloid lineage cells but not on T or B lymphocytes, which may be a novel immune checkpoint of tumor-associated macrophages (PMID: 20603617; 39429877).