Tested Applications
Positive WB detected in | mouse kidney tissue, rat kidney tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 4 publications below |
IHC | See 1 publications below |
IF | See 1 publications below |
Product Information
22144-1-AP targets LY6E in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag17573 Product name: Recombinant human LY6E protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 21-101 aa of BC119708 Sequence: LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFS Predict reactive species |
Full Name | lymphocyte antigen 6 complex, locus E |
Calculated Molecular Weight | 131 aa, 14 kDa |
Observed Molecular Weight | 12-16 kDa |
GenBank Accession Number | BC119708 |
Gene Symbol | LY6E |
Gene ID (NCBI) | 4061 |
RRID | AB_2879007 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q16553 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The predicted MW of LY6E is 13 kDa. Catalog#22144-1-AP recognises two band of 13 kDa and 18 kDa, and the additional 18 kDa band may be due to glycosylation.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for LY6E antibody 22144-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Lab Chip LY6E protein facilitates adeno-associated virus crossing in a biomimetic chip model of the human blood-brain barrier | ||
Carcinogenesis α5-nAChR associated with Ly6E modulates cell migration via TGF-β1/Smad signaling in non-small cell lung cancer. | ||
J Virol LY6E Restricts the Entry of Human Coronaviruses, Including the Currently Pandemic SARS-CoV-2.
| ||