LY6G6F Polyclonal antibody, PBS Only

• 

  WB analysis of HL-60 using 25872-1-AP (same clone as 25872-1-PBS)

  HL-60 cells were subjected to SDS PAGE followed by western blot with 25872-1-AP (LY6G6F Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25872-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 25872-1-AP (same clone as 25872-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 25872-1-AP (LY6G6F Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25872-1-PBS in a different storage buffer formulation.

LY6G6F Polyclonal Antibody for WB, Indirect ELISA

Cat No. 25872-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

25872-1-PBS targets LY6G6F in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22467

  Product name: Recombinant human LY6G6F protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 18-238 aa of BC137212

  Sequence: DNMQAIYVALGEAVELPCPSPPTLHGDEHLSWFCSPAAGSFTTLVAQVQVGRPAPDPGKPGRESRLRLLGNYSLWLEGSKEEDAGRYWCAVLGQHHNYQNWRVYDVLVLKGSQLSARAADGSPCNVLLCSVVPSRRMDSVTWQEGKGPVRGRVQSFWGSEAALLLVCPGEGLSEPRSRRPRIIRCLMTHNKGVSFSLAASIDASPALCAPSTGWDMPWILM

• Full Name: lymphocyte antigen 6 complex, locus G6F
• Calculated Molecular Weight: 297 aa, 32 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC137212
• Gene Symbol: LY6G6F
• Gene ID (NCBI): 259215
• RRID: AB_2880278
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5SQ64
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

LY6G6F, also named as C6orf21, G6F, LY6G6D and NG32, plays a role in the downstream signal transduction pathways involving GRB2 and GRB7. It has monomer (~30 kda) and homodimer (~60 kDa).