LY6G6F Polyclonal antibody

• 

  WB analysis of HepG2 using 25872-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 25872-1-AP (LY6G6F Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HL-60 using 25872-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 25872-1-AP (LY6G6F Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

LY6G6F Polyclonal Antibody for WB, ELISA

Cat No. 25872-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IF, ELISA

Synonyms

C6orf21, G6f, LY6G6D, LY6G6F, NG32

---

Tested Applications

• Positive WB detected in: HepG2 cells, HL-60 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IF: See 1 publications below

Product Information

25872-1-AP targets LY6G6F in WB, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22467

  Product name: Recombinant human LY6G6F protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 18-238 aa of BC137212

  Sequence: DNMQAIYVALGEAVELPCPSPPTLHGDEHLSWFCSPAAGSFTTLVAQVQVGRPAPDPGKPGRESRLRLLGNYSLWLEGSKEEDAGRYWCAVLGQHHNYQNWRVYDVLVLKGSQLSARAADGSPCNVLLCSVVPSRRMDSVTWQEGKGPVRGRVQSFWGSEAALLLVCPGEGLSEPRSRRPRIIRCLMTHNKGVSFSLAASIDASPALCAPSTGWDMPWILM

• Full Name: lymphocyte antigen 6 complex, locus G6F
• Calculated Molecular Weight: 297 aa, 32 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC137212
• Gene Symbol: LY6G6F
• Gene ID (NCBI): 259215
• RRID: AB_2880278
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5SQ64
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LY6G6F, also named as C6orf21, G6F, LY6G6D and NG32, plays a role in the downstream signal transduction pathways involving GRB2 and GRB7. It has monomer (~30 kda) and homodimer (~60 kDa).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Arterioscler Thromb Vasc Biol; Caspase-8 Promotes Pulmonary Hypertension by Activating Macrophage-Associated Inflammation and IL-1β (Interleukin 1β) Production.; Authors - Wuwei Rong