Tested Applications
Positive IHC detected in | human oesophagus cancer tissue, mouse brain tissue, human oesophagus tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
13373-1-AP targets LYNX1 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag4195 Product name: Recombinant human LYNX1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 21-131 aa of BC032306 Sequence: LDCHVCAYNGDNCFNPMRCPAMVAYCMTTRTSAAEAIWCHQCTGFGGCSHGSRCLRDSTHCVTTATRVLSNTEDLPLVTKMCHIGCPDIPSLGLGPYVSIACCQTSLCNHD Predict reactive species |
Full Name | Ly6/neurotoxin 1 |
Calculated Molecular Weight | 131 aa, 14 kDa |
GenBank Accession Number | BC032306 |
Gene Symbol | LYNX1 |
Gene ID (NCBI) | 66004 |
RRID | AB_2877944 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9BZG9 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
LYNX1, also named as SLURP2, is a neuronal membrane molecule related to snake a-neurotoxins able to modulate nicotinic acetylcholine receptors (nAChRs). It acts in different tissues through interaction to nAChRs to balance neuronal activity.
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for LYNX1 antibody 13373-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |