Mouse LYPD8 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 87446-1-RR (same clone as 87446-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87446-1-RR ( LYPD8 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87446-1-PBS in a different storage buffer formulation.

• 

  Affinity of 87446-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87446-1-RR against Mouse LYPD8 were performed. The affinity constant is 20.0 nM.

LYPD8 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87446-1-PBS

Clone No.252926G3

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, Indirect ELISA

Synonyms

Ly6/PLAUR domain-containing protein 8

---

Product Information

87446-1-PBS targets LYPD8 in WB, Indirect ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg7518

  Product name: Recombinant mouse Lypd8 protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 21-255 aa of NM_001083884.1

  Sequence: LNCTQCYTYNSTCDGQATECNEQSFSCVESSINSTLGGFLHVYQNKFCSASNCTENSTEVAFTVHLFDDQRYHFASQCCQGESCNATHSESGTQNVTDMQCMSCYGHNKTLCEEKPQKCYEGEQCVFIIAEMVNGSGRVELKGCSDISNSTCQFLSPGNTTVGEFVFKSVECTQPTEYTNSTTTIPPITNTSLTSVTRPGIKTSPASVTPQASMGTKASFTSSIFGSLLLLKLLF

• Full Name: RIKEN cDNA 2210415F13 gene
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 75 kDa, 45 kDa
• GenBank Accession Number: NM_001083884.1
• Gene Symbol: 2210415F13Rik
• Gene ID (NCBI): 70163
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9D7S0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Ly6/PLAUR domain-containing protein 8 (LYPD8) is a highly glycosylated glycosylphosphatidylinositol-anchored protein, which is anchored to intestinal epithelial cells in the uppermost epithelial layer, is constitutively shed into the intestinal lumen and preferentially binds to flagellated bacteria from various genera (PMID: 27027293; 29259722). It has been reported that Lypd8 mediates the segregation of intestinal bacteria and epithelial cells in the colon, thereby preserving intestinal homeostasis (PMID: 27027293). The higher observed molecular weight of LYPD8 is 75 kDa, due to glycosylation modification (PMID: 29259722).