LYVE1 Polyclonal antibody, PBS Only

• 

  WB analysis using 28321-1-AP (same clone as 28321-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28321-1-AP (LYVE1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28321-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 28321-1-AP (same clone as 28321-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28321-1-AP (LYVE1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28321-1-PBS in a different storage buffer formulation.

LYVE1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 28321-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Cell surface retention sequence-binding protein 1, CRSBP 1, CRSBP1, CRSBP-1, Extracellular link domain-containing protein 1

---

Product Information

28321-1-PBS targets LYVE1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28131

  Product name: Recombinant human LYVE1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 192-322 aa of BC026231

  Sequence: SIPRRKKLICVTEVFMETSTMSTETEPFVENKAAFKNEAAGFGGVPTALLVLALLFFGAAAGLGFCYVKRYVKAFPFTNKNQQKEMIETKVVKEEKANDSNPNEESKKTDKNPEESKSPSKTTVRCLEAEV

• Full Name: lymphatic vessel endothelial hyaluronan receptor 1
• Calculated Molecular Weight: 322 aa, 35 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC026231
• Gene Symbol: LYVE1
• Gene ID (NCBI): 10894
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y5Y7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

LYVE1 is a 322-amino acid type-I integral membrane glycoprotein primarily expressed on lymphatic endothelial cells. LYVE1 is a CD44 homologue. It acts as a receptor and binds to both soluble and immobilized hyaluronan. LYVE1 may function in lymphatic hyaluronan transport and have a role in tumor metastasis.