LYVE1 Polyclonal antibody

• 

  WB analysis using 28321-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28321-1-AP (LYVE1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 28321-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28321-1-AP (LYVE1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

LYVE1 Polyclonal Antibody for WB, ELISA

Cat No. 28321-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, ELISA

Synonyms

Cell surface retention sequence-binding protein 1, CRSBP 1, CRSBP1, CRSBP-1, Extracellular link domain-containing protein 1

---

Tested Applications

• Positive WB detected in: HUVEC cells, bEnd.3 cells, mouse heart tissue, rat heart tissue, mouse liver tissue, rat liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IF: See 1 publications below

Product Information

28321-1-AP targets LYVE1 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28131

  Product name: Recombinant human LYVE1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 192-322 aa of BC026231

  Sequence: SIPRRKKLICVTEVFMETSTMSTETEPFVENKAAFKNEAAGFGGVPTALLVLALLFFGAAAGLGFCYVKRYVKAFPFTNKNQQKEMIETKVVKEEKANDSNPNEESKKTDKNPEESKSPSKTTVRCLEAEV

• Full Name: lymphatic vessel endothelial hyaluronan receptor 1
• Calculated Molecular Weight: 322 aa, 35 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC026231
• Gene Symbol: LYVE1
• Gene ID (NCBI): 10894
• RRID: AB_3086043
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y5Y7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LYVE1 is a 322-amino acid type-I integral membrane glycoprotein primarily expressed on lymphatic endothelial cells. LYVE1 is a CD44 homologue. It acts as a receptor and binds to both soluble and immobilized hyaluronan. LYVE1 may function in lymphatic hyaluronan transport and have a role in tumor metastasis.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Exp Eye Res; Distinct Activation of M1 and M2 Macrophages in the Primary Pterygium Lymphangiogenesis; Authors - Soo Jin Lee
mouse	WB	J Adv Res; Aquaporin 4 and its isoforms regulation ameliorate AQP4 Mis-localization-induced glymphatic dysfunction in ischemic stroke; Authors - Hanhong Zhang