Rat Lipocalin-2/NGAL Recombinant monoclonal antibody, PBS Only (Detector)

• 

  Sandwich ELISA sample test of MP00790-4

  The mean Lipocalin-2/NGAL concentration was determined to be 13,314.6 pg/mL in rat kidney tissue extract based on a 2.0 mg/mL extract load and 39,497.5 pg/mL in rat lung tissue extract based on a 1.0 mg/mL extract load.

• 

  Sandwich ELISA sample test of MP00790-4

  Serum of sixteen rats was measured. The Lipocalin-2/NGAL concentration of detected samples was determined to be 91.9 ng/mL with a range of 54.4 - 142.6 ng/mL.

• 

  Sandwich ELISA standard curve of MP00790-4

  Sandwich ELISA standard curve of MP00790-4, Rat Lipocalin-2/NGAL Recombinant Matched Antibody Pair - PBS only. 83853-4-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg1022. 83853-5-PBS was HRP conjugated as the detection antibody. Range: 7.8-500 pg/mL.

• 

  Affinity and Kinetic Characterization of 83853-5-PBS

  Biolayer interferometry (BLl) kinetic assays of 83853-5-PBS against Rat Lipocalin-2/NGAL were performed. The affinity constant is 2.34 nM.

Lipocalin-2/NGAL Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA

Cat No. 83853-5-PBS

Clone No.240792D7

Host / Isotype

Rabbit / IgG

Reactivity

rat

Applications

Sandwich ELISA, Indirect ELISA

Synonyms

Lcn2, Lipocalin2/NGAL, Alpha-2-microglobulin-related protein, Alpha-2U globulin-related protein, lipocalin 2

---

Product Information

83853-5-PBS targets Lipocalin-2/NGAL as part of a matched antibody pair:

MP00790-4: 83853-4-PBS capture and 83853-5-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1022

  Product name: Recombinant Rat Lipocalin-2/NGAL protein (His Tag) (HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 21-198 aa of

  Sequence: QDSTQNLIPAPPLISVPLQPGFWTERFQGRWFVVGLAGNAVQKERQSRFTMYSTIYELQEDNSYNVTSILVRGQGCRYWIRTFVPSSRPGQFTLGNIHSYPQIQSYDVQVADTDYDQFAMVFFQKTSENKQYFKVTLYGRTKGLSDELKERFVSFAKSLGLKDNNIVFSVPTDQCIDN

• Full Name: lipocalin 2
• Calculated Molecular Weight: 22kDa
• Gene Symbol: Lipocalin-2/NGAL
• Gene ID (NCBI): 170496
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P30152
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.